Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AABA74_RS12090 | Genome accession | NZ_AP028932 |
| Coordinates | 2490816..2490989 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain RB.IBE29 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2485816..2495989
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABA74_RS12075 (RBIBE_23230) | gcvT | 2486634..2487734 (-) | 1101 | WP_338260609.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AABA74_RS12080 (RBIBE_23240) | - | 2488157..2489827 (+) | 1671 | WP_058906183.1 | SNF2-related protein | - |
| AABA74_RS12085 (RBIBE_23250) | - | 2489845..2490639 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| AABA74_RS12090 (RBIBE_23260) | sinI | 2490816..2490989 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| AABA74_RS12095 (RBIBE_23270) | sinR | 2491023..2491358 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AABA74_RS12100 (RBIBE_23280) | - | 2491406..2492191 (-) | 786 | WP_003153102.1 | TasA family protein | - |
| AABA74_RS12105 (RBIBE_23290) | - | 2492255..2492839 (-) | 585 | WP_046559873.1 | signal peptidase I | - |
| AABA74_RS12110 (RBIBE_23300) | tapA | 2492811..2493482 (-) | 672 | WP_046559874.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AABA74_RS12115 (RBIBE_23310) | - | 2493741..2494070 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| AABA74_RS12120 (RBIBE_23320) | - | 2494110..2494289 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AABA74_RS12125 (RBIBE_23330) | comGG | 2494346..2494723 (-) | 378 | WP_046559875.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AABA74_RS12130 (RBIBE_23340) | comGF | 2494724..2495119 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| AABA74_RS12135 (RBIBE_23350) | comGE | 2495133..2495447 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AABA74_RS12140 (RBIBE_23360) | comGD | 2495431..2495868 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=107424 AABA74_RS12090 WP_003153105.1 2490816..2490989(+) (sinI) [Bacillus velezensis strain RB.IBE29]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=107424 AABA74_RS12090 WP_003153105.1 2490816..2490989(+) (sinI) [Bacillus velezensis strain RB.IBE29]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |