Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ABXH30_RS13300 Genome accession   NZ_CP173259
Coordinates   2686906..2687283 (-) Length   125 a.a.
NCBI ID   WP_014305410.1    Uniprot ID   -
Organism   Bacillus velezensis strain XW38     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2681906..2692283
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXH30_RS13260 (ABXH30_13260) - 2682405..2683199 (+) 795 WP_201489007.1 YqhG family protein -
  ABXH30_RS13265 (ABXH30_13265) sinI 2683376..2683549 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ABXH30_RS13270 (ABXH30_13270) sinR 2683583..2683918 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABXH30_RS13275 (ABXH30_13275) tasA 2683966..2684751 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ABXH30_RS13280 (ABXH30_13280) sipW 2684815..2685399 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ABXH30_RS13285 (ABXH30_13285) tapA 2685371..2686042 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  ABXH30_RS13290 (ABXH30_13290) - 2686301..2686630 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ABXH30_RS13295 (ABXH30_13295) - 2686670..2686849 (-) 180 WP_003153093.1 YqzE family protein -
  ABXH30_RS13300 (ABXH30_13300) comGG 2686906..2687283 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABXH30_RS13305 (ABXH30_13305) comGF 2687284..2687784 (-) 501 WP_236583338.1 competence type IV pilus minor pilin ComGF -
  ABXH30_RS13310 (ABXH30_13310) comGE 2687693..2688007 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABXH30_RS13315 (ABXH30_13315) comGD 2687991..2688428 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  ABXH30_RS13320 (ABXH30_13320) comGC 2688418..2688726 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ABXH30_RS13325 (ABXH30_13325) comGB 2688731..2689768 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  ABXH30_RS13330 (ABXH30_13330) comGA 2689755..2690825 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ABXH30_RS13335 (ABXH30_13335) - 2691017..2691967 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14170.14 Da        Isoelectric Point: 9.9592

>NTDB_id=1071177 ABXH30_RS13300 WP_014305410.1 2686906..2687283(-) (comGG) [Bacillus velezensis strain XW38]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1071177 ABXH30_RS13300 WP_014305410.1 2686906..2687283(-) (comGG) [Bacillus velezensis strain XW38]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment