Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ABXH30_RS13265 Genome accession   NZ_CP173259
Coordinates   2683376..2683549 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain XW38     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2678376..2688549
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXH30_RS13250 (ABXH30_13250) gcvT 2679194..2680294 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  ABXH30_RS13255 (ABXH30_13255) - 2680717..2682387 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  ABXH30_RS13260 (ABXH30_13260) - 2682405..2683199 (+) 795 WP_201489007.1 YqhG family protein -
  ABXH30_RS13265 (ABXH30_13265) sinI 2683376..2683549 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ABXH30_RS13270 (ABXH30_13270) sinR 2683583..2683918 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ABXH30_RS13275 (ABXH30_13275) tasA 2683966..2684751 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ABXH30_RS13280 (ABXH30_13280) sipW 2684815..2685399 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ABXH30_RS13285 (ABXH30_13285) tapA 2685371..2686042 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  ABXH30_RS13290 (ABXH30_13290) - 2686301..2686630 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ABXH30_RS13295 (ABXH30_13295) - 2686670..2686849 (-) 180 WP_003153093.1 YqzE family protein -
  ABXH30_RS13300 (ABXH30_13300) comGG 2686906..2687283 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ABXH30_RS13305 (ABXH30_13305) comGF 2687284..2687784 (-) 501 WP_236583338.1 competence type IV pilus minor pilin ComGF -
  ABXH30_RS13310 (ABXH30_13310) comGE 2687693..2688007 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ABXH30_RS13315 (ABXH30_13315) comGD 2687991..2688428 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1071175 ABXH30_RS13265 WP_003153105.1 2683376..2683549(+) (sinI) [Bacillus velezensis strain XW38]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1071175 ABXH30_RS13265 WP_003153105.1 2683376..2683549(+) (sinI) [Bacillus velezensis strain XW38]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment