Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ABXH30_RS13265 | Genome accession | NZ_CP173259 |
| Coordinates | 2683376..2683549 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain XW38 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2678376..2688549
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABXH30_RS13250 (ABXH30_13250) | gcvT | 2679194..2680294 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ABXH30_RS13255 (ABXH30_13255) | - | 2680717..2682387 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| ABXH30_RS13260 (ABXH30_13260) | - | 2682405..2683199 (+) | 795 | WP_201489007.1 | YqhG family protein | - |
| ABXH30_RS13265 (ABXH30_13265) | sinI | 2683376..2683549 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ABXH30_RS13270 (ABXH30_13270) | sinR | 2683583..2683918 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ABXH30_RS13275 (ABXH30_13275) | tasA | 2683966..2684751 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ABXH30_RS13280 (ABXH30_13280) | sipW | 2684815..2685399 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ABXH30_RS13285 (ABXH30_13285) | tapA | 2685371..2686042 (-) | 672 | WP_003153099.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ABXH30_RS13290 (ABXH30_13290) | - | 2686301..2686630 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ABXH30_RS13295 (ABXH30_13295) | - | 2686670..2686849 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ABXH30_RS13300 (ABXH30_13300) | comGG | 2686906..2687283 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ABXH30_RS13305 (ABXH30_13305) | comGF | 2687284..2687784 (-) | 501 | WP_236583338.1 | competence type IV pilus minor pilin ComGF | - |
| ABXH30_RS13310 (ABXH30_13310) | comGE | 2687693..2688007 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ABXH30_RS13315 (ABXH30_13315) | comGD | 2687991..2688428 (-) | 438 | WP_043867285.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1071175 ABXH30_RS13265 WP_003153105.1 2683376..2683549(+) (sinI) [Bacillus velezensis strain XW38]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1071175 ABXH30_RS13265 WP_003153105.1 2683376..2683549(+) (sinI) [Bacillus velezensis strain XW38]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |