Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AB4Z44_RS06375 | Genome accession | NZ_CP173258 |
| Coordinates | 1359201..1359731 (-) | Length | 176 a.a. |
| NCBI ID | WP_404713225.1 | Uniprot ID | - |
| Organism | Sphingomonas sp. MMS24-J13 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1303152..1359731 | 1359201..1359731 | within | 0 |
Gene organization within MGE regions
Location: 1303152..1359731
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB4Z44_RS06010 (AB4Z44_06010) | - | 1303152..1304798 (+) | 1647 | WP_404713155.1 | AmpG family muropeptide MFS transporter | - |
| AB4Z44_RS06015 (AB4Z44_06015) | - | 1304845..1305195 (-) | 351 | WP_404713156.1 | DUF952 domain-containing protein | - |
| AB4Z44_RS06020 (AB4Z44_06020) | gyrA | 1305188..1307980 (-) | 2793 | WP_404713157.1 | DNA gyrase subunit A | - |
| AB4Z44_RS06025 (AB4Z44_06025) | - | 1308115..1308351 (-) | 237 | WP_404713158.1 | DUF6356 family protein | - |
| AB4Z44_RS06030 (AB4Z44_06030) | - | 1308551..1309804 (+) | 1254 | WP_404713159.1 | hypothetical protein | - |
| AB4Z44_RS06035 (AB4Z44_06035) | - | 1309974..1310453 (-) | 480 | WP_404713160.1 | Lrp/AsnC family transcriptional regulator | - |
| AB4Z44_RS06045 (AB4Z44_06045) | - | 1310816..1312156 (+) | 1341 | WP_404713161.1 | tyrosine-type recombinase/integrase | - |
| AB4Z44_RS06050 (AB4Z44_06050) | - | 1312158..1312367 (-) | 210 | WP_404713162.1 | helix-turn-helix transcriptional regulator | - |
| AB4Z44_RS06055 (AB4Z44_06055) | - | 1312518..1312706 (-) | 189 | Protein_1199 | ClpX C4-type zinc finger protein | - |
| AB4Z44_RS06060 (AB4Z44_06060) | - | 1312703..1313371 (-) | 669 | WP_404713163.1 | hypothetical protein | - |
| AB4Z44_RS06065 (AB4Z44_06065) | - | 1313325..1313705 (-) | 381 | WP_404713164.1 | hypothetical protein | - |
| AB4Z44_RS06070 (AB4Z44_06070) | - | 1313702..1314025 (-) | 324 | WP_404713165.1 | hypothetical protein | - |
| AB4Z44_RS06075 (AB4Z44_06075) | - | 1314159..1314359 (-) | 201 | WP_404713166.1 | hypothetical protein | - |
| AB4Z44_RS06080 (AB4Z44_06080) | - | 1314356..1314856 (-) | 501 | WP_404713167.1 | hypothetical protein | - |
| AB4Z44_RS06085 (AB4Z44_06085) | - | 1314856..1315107 (-) | 252 | WP_404713168.1 | hypothetical protein | - |
| AB4Z44_RS06090 (AB4Z44_06090) | - | 1315100..1315441 (-) | 342 | WP_404713169.1 | hypothetical protein | - |
| AB4Z44_RS06095 (AB4Z44_06095) | - | 1315434..1316144 (-) | 711 | WP_404713170.1 | hypothetical protein | - |
| AB4Z44_RS06100 (AB4Z44_06100) | - | 1316144..1316689 (-) | 546 | WP_404713171.1 | hypothetical protein | - |
| AB4Z44_RS06105 (AB4Z44_06105) | - | 1316887..1317513 (-) | 627 | WP_404713172.1 | helix-turn-helix transcriptional regulator | - |
| AB4Z44_RS06110 (AB4Z44_06110) | - | 1317642..1317845 (+) | 204 | WP_404713173.1 | hypothetical protein | - |
| AB4Z44_RS06115 (AB4Z44_06115) | - | 1317920..1318861 (+) | 942 | WP_404713174.1 | CHC2 zinc finger domain-containing protein | - |
| AB4Z44_RS06120 (AB4Z44_06120) | - | 1318858..1320366 (+) | 1509 | WP_404713175.1 | YfjI family protein | - |
| AB4Z44_RS06125 (AB4Z44_06125) | - | 1320363..1320809 (+) | 447 | WP_404713176.1 | hypothetical protein | - |
| AB4Z44_RS06130 (AB4Z44_06130) | - | 1321243..1321863 (+) | 621 | WP_404713177.1 | hypothetical protein | - |
| AB4Z44_RS06135 (AB4Z44_06135) | - | 1322257..1323114 (+) | 858 | WP_404713178.1 | hypothetical protein | - |
| AB4Z44_RS06140 (AB4Z44_06140) | - | 1323111..1323992 (+) | 882 | WP_404713179.1 | SGNH/GDSL hydrolase family protein | - |
| AB4Z44_RS06145 (AB4Z44_06145) | - | 1324005..1324409 (+) | 405 | WP_404713180.1 | hypothetical protein | - |
| AB4Z44_RS06150 (AB4Z44_06150) | - | 1324536..1324745 (+) | 210 | WP_404713181.1 | HNH endonuclease | - |
| AB4Z44_RS06155 (AB4Z44_06155) | - | 1324742..1324930 (+) | 189 | WP_404713182.1 | hypothetical protein | - |
| AB4Z44_RS06160 (AB4Z44_06160) | - | 1324927..1325163 (+) | 237 | WP_404713183.1 | hypothetical protein | - |
| AB4Z44_RS06165 (AB4Z44_06165) | - | 1325439..1325786 (+) | 348 | WP_404713184.1 | hypothetical protein | - |
| AB4Z44_RS06170 (AB4Z44_06170) | - | 1325728..1327533 (+) | 1806 | WP_404713185.1 | terminase large subunit | - |
| AB4Z44_RS06175 (AB4Z44_06175) | - | 1327542..1328765 (+) | 1224 | WP_404713186.1 | phage portal protein | - |
| AB4Z44_RS06180 (AB4Z44_06180) | - | 1328775..1329458 (+) | 684 | WP_404713187.1 | HK97 family phage prohead protease | - |
| AB4Z44_RS06185 (AB4Z44_06185) | - | 1329488..1330774 (+) | 1287 | WP_404713188.1 | phage major capsid protein | - |
| AB4Z44_RS06190 (AB4Z44_06190) | - | 1330833..1331072 (+) | 240 | WP_404713189.1 | hypothetical protein | - |
| AB4Z44_RS06195 (AB4Z44_06195) | - | 1331069..1331485 (+) | 417 | WP_404713190.1 | hypothetical protein | - |
| AB4Z44_RS06200 (AB4Z44_06200) | - | 1331488..1332057 (+) | 570 | WP_404713191.1 | head-tail connector protein | - |
| AB4Z44_RS06205 (AB4Z44_06205) | - | 1332054..1332407 (+) | 354 | WP_404713192.1 | head-tail adaptor protein | - |
| AB4Z44_RS06210 (AB4Z44_06210) | - | 1332404..1332850 (+) | 447 | WP_404713193.1 | hypothetical protein | - |
| AB4Z44_RS06215 (AB4Z44_06215) | - | 1332854..1333246 (+) | 393 | WP_404713194.1 | DUF3168 domain-containing protein | - |
| AB4Z44_RS06220 (AB4Z44_06220) | - | 1333258..1333443 (+) | 186 | WP_404713195.1 | hypothetical protein | - |
| AB4Z44_RS06225 (AB4Z44_06225) | - | 1333468..1333899 (+) | 432 | WP_404713196.1 | phage tail tube protein | - |
| AB4Z44_RS06230 (AB4Z44_06230) | - | 1333902..1334303 (+) | 402 | WP_404713197.1 | hypothetical protein | - |
| AB4Z44_RS06235 (AB4Z44_06235) | - | 1334570..1337728 (+) | 3159 | WP_404713198.1 | phage tail tape measure protein | - |
| AB4Z44_RS06240 (AB4Z44_06240) | - | 1337728..1338366 (+) | 639 | WP_404713199.1 | hypothetical protein | - |
| AB4Z44_RS06245 (AB4Z44_06245) | - | 1338363..1338998 (+) | 636 | WP_404713200.1 | hypothetical protein | - |
| AB4Z44_RS06250 (AB4Z44_06250) | - | 1339034..1339357 (+) | 324 | WP_404714363.1 | DUF6950 family protein | - |
| AB4Z44_RS06255 (AB4Z44_06255) | - | 1339317..1339634 (-) | 318 | WP_404713201.1 | hypothetical protein | - |
| AB4Z44_RS06260 (AB4Z44_06260) | - | 1339674..1341839 (+) | 2166 | WP_404713202.1 | hypothetical protein | - |
| AB4Z44_RS06265 (AB4Z44_06265) | - | 1341883..1342296 (+) | 414 | WP_404713203.1 | hypothetical protein | - |
| AB4Z44_RS06270 (AB4Z44_06270) | - | 1342296..1343201 (+) | 906 | WP_404713204.1 | hypothetical protein | - |
| AB4Z44_RS06275 (AB4Z44_06275) | - | 1343207..1345570 (+) | 2364 | WP_404713205.1 | hypothetical protein | - |
| AB4Z44_RS06280 (AB4Z44_06280) | - | 1345618..1346073 (+) | 456 | WP_404713206.1 | hypothetical protein | - |
| AB4Z44_RS06285 (AB4Z44_06285) | - | 1346077..1348266 (+) | 2190 | WP_404713207.1 | hypothetical protein | - |
| AB4Z44_RS06290 (AB4Z44_06290) | - | 1348342..1348737 (+) | 396 | WP_404713208.1 | hypothetical protein | - |
| AB4Z44_RS06295 (AB4Z44_06295) | - | 1348734..1349231 (+) | 498 | WP_404713209.1 | hypothetical protein | - |
| AB4Z44_RS06300 (AB4Z44_06300) | - | 1349364..1350059 (+) | 696 | WP_404713210.1 | glycoside hydrolase family 19 protein | - |
| AB4Z44_RS06305 (AB4Z44_06305) | - | 1350056..1350298 (+) | 243 | WP_404713211.1 | hypothetical protein | - |
| AB4Z44_RS06310 (AB4Z44_06310) | - | 1350295..1350669 (+) | 375 | WP_404713212.1 | hypothetical protein | - |
| AB4Z44_RS06315 (AB4Z44_06315) | - | 1350614..1350853 (+) | 240 | WP_404713213.1 | hypothetical protein | - |
| AB4Z44_RS06320 (AB4Z44_06320) | - | 1350850..1351071 (-) | 222 | WP_404713214.1 | hypothetical protein | - |
| AB4Z44_RS06325 (AB4Z44_06325) | - | 1351086..1351217 (-) | 132 | WP_404713215.1 | hypothetical protein | - |
| AB4Z44_RS06330 (AB4Z44_06330) | - | 1351221..1351514 (-) | 294 | WP_404713216.1 | helix-turn-helix domain-containing protein | - |
| AB4Z44_RS06335 (AB4Z44_06335) | - | 1351544..1351819 (-) | 276 | WP_404713217.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| AB4Z44_RS06340 (AB4Z44_06340) | - | 1351806..1352000 (-) | 195 | WP_404713218.1 | hypothetical protein | - |
| AB4Z44_RS06345 (AB4Z44_06345) | glpD | 1352589..1354061 (-) | 1473 | WP_404713219.1 | glycerol-3-phosphate dehydrogenase | - |
| AB4Z44_RS06350 (AB4Z44_06350) | glpK | 1354072..1355559 (-) | 1488 | WP_404713220.1 | glycerol kinase GlpK | - |
| AB4Z44_RS06355 (AB4Z44_06355) | - | 1355571..1356377 (-) | 807 | WP_404713221.1 | MIP/aquaporin family protein | - |
| AB4Z44_RS06360 (AB4Z44_06360) | - | 1356556..1357107 (+) | 552 | WP_404713222.1 | DUF4126 domain-containing protein | - |
| AB4Z44_RS06365 (AB4Z44_06365) | - | 1357104..1358480 (+) | 1377 | WP_404713223.1 | FAD-containing oxidoreductase | - |
| AB4Z44_RS06370 (AB4Z44_06370) | - | 1358634..1359197 (+) | 564 | WP_404713224.1 | hypothetical protein | - |
| AB4Z44_RS06375 (AB4Z44_06375) | ssb | 1359201..1359731 (-) | 531 | WP_404713225.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 176 a.a. Molecular weight: 18682.40 Da Isoelectric Point: 5.3476
>NTDB_id=1071127 AB4Z44_RS06375 WP_404713225.1 1359201..1359731(-) (ssb) [Sphingomonas sp. MMS24-J13]
MAGSVNKVILVGNLGRDPESKSFQNGGKVVNLRIATSENWKDRATGERKEKTEWHSVAIFNEPLANTAERFLRKGSKVYI
EGQLQTRKWQDQSGNDRYSTEIVLQGFNAVLVLLDRREGEGGGASDRGGWGEDSNSSFVGGGAGGGGYGGGSRGGGASTG
GRPAPFDSDLDDDVPF
MAGSVNKVILVGNLGRDPESKSFQNGGKVVNLRIATSENWKDRATGERKEKTEWHSVAIFNEPLANTAERFLRKGSKVYI
EGQLQTRKWQDQSGNDRYSTEIVLQGFNAVLVLLDRREGEGGGASDRGGWGEDSNSSFVGGGAGGGGYGGGSRGGGASTG
GRPAPFDSDLDDDVPF
Nucleotide
Download Length: 531 bp
>NTDB_id=1071127 AB4Z44_RS06375 WP_404713225.1 1359201..1359731(-) (ssb) [Sphingomonas sp. MMS24-J13]
ATGGCCGGCAGCGTCAACAAGGTCATATTGGTCGGCAATCTCGGACGCGATCCCGAGTCGAAGAGCTTCCAGAATGGCGG
CAAGGTCGTGAACCTGCGCATCGCCACGTCCGAGAACTGGAAGGATCGCGCGACGGGCGAGCGCAAGGAGAAGACCGAAT
GGCATTCGGTCGCGATCTTCAACGAGCCGCTTGCCAACACCGCCGAGCGCTTCCTGCGCAAGGGCAGCAAGGTCTACATC
GAAGGGCAGTTGCAAACTCGCAAATGGCAGGATCAGAGCGGCAATGACCGCTATTCGACCGAGATCGTGCTGCAGGGCTT
CAACGCCGTGCTCGTCCTGCTCGATCGCCGTGAAGGCGAAGGTGGCGGCGCATCGGACCGCGGCGGCTGGGGCGAGGATT
CGAACAGCAGTTTCGTCGGCGGCGGTGCCGGTGGTGGCGGCTATGGCGGTGGGAGCCGCGGTGGCGGCGCCAGCACGGGC
GGCCGCCCTGCCCCGTTCGACAGCGATCTCGACGACGACGTGCCGTTCTGA
ATGGCCGGCAGCGTCAACAAGGTCATATTGGTCGGCAATCTCGGACGCGATCCCGAGTCGAAGAGCTTCCAGAATGGCGG
CAAGGTCGTGAACCTGCGCATCGCCACGTCCGAGAACTGGAAGGATCGCGCGACGGGCGAGCGCAAGGAGAAGACCGAAT
GGCATTCGGTCGCGATCTTCAACGAGCCGCTTGCCAACACCGCCGAGCGCTTCCTGCGCAAGGGCAGCAAGGTCTACATC
GAAGGGCAGTTGCAAACTCGCAAATGGCAGGATCAGAGCGGCAATGACCGCTATTCGACCGAGATCGTGCTGCAGGGCTT
CAACGCCGTGCTCGTCCTGCTCGATCGCCGTGAAGGCGAAGGTGGCGGCGCATCGGACCGCGGCGGCTGGGGCGAGGATT
CGAACAGCAGTTTCGTCGGCGGCGGTGCCGGTGGTGGCGGCTATGGCGGTGGGAGCCGCGGTGGCGGCGCCAGCACGGGC
GGCCGCCCTGCCCCGTTCGACAGCGATCTCGACGACGACGTGCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
46.237 |
100 |
0.489 |
| ssb | Vibrio cholerae strain A1552 |
48.851 |
98.864 |
0.483 |
| ssb | Neisseria gonorrhoeae MS11 |
37.64 |
100 |
0.381 |
| ssb | Neisseria meningitidis MC58 |
37.079 |
100 |
0.375 |