Detailed information NTG1070122

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACIGXT_RS12025
• Genome accession: NZ_CP173038
• Coordinates: 2479485..2479922 (-)
• Length: 145 a.a.
• NCBI ID: WP_044053464.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain Shannan.BV80-12
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2474485..2484922

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACIGXT_RS11975 (ACIGXT_11975)	sinI	2474869..2475042 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACIGXT_RS11980 (ACIGXT_11980)	sinR	2475076..2475411 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACIGXT_RS11985 (ACIGXT_11985)	tasA	2475459..2476244 (-)	786	WP_003153102.1	biofilm matrix protein TasA	-
ACIGXT_RS11990 (ACIGXT_11990)	sipW	2476308..2476892 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ACIGXT_RS11995 (ACIGXT_11995)	tapA	2476864..2477535 (-)	672	WP_024085598.1	amyloid fiber anchoring/assembly protein TapA	-
ACIGXT_RS12000 (ACIGXT_12000)	-	2477795..2478124 (+)	330	WP_003153097.1	DUF3889 domain-containing protein	-
ACIGXT_RS12005 (ACIGXT_12005)	-	2478164..2478343 (-)	180	WP_003153093.1	YqzE family protein	-
ACIGXT_RS12010 (ACIGXT_12010)	comGG	2478400..2478777 (-)	378	WP_014305410.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACIGXT_RS12015 (ACIGXT_12015)	comGF	2478778..2479173 (-)	396	WP_046559876.1	competence type IV pilus minor pilin ComGF	-
ACIGXT_RS12020 (ACIGXT_12020)	comGE	2479187..2479501 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACIGXT_RS12025 (ACIGXT_12025)	comGD	2479485..2479922 (-)	438	WP_044053464.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACIGXT_RS12030 (ACIGXT_12030)	comGC	2479912..2480178 (-)	267	WP_042635730.1	competence type IV pilus major pilin ComGC	Machinery gene
ACIGXT_RS12035 (ACIGXT_12035)	comGB	2480225..2481262 (-)	1038	WP_024085602.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACIGXT_RS12040 (ACIGXT_12040)	comGA	2481249..2482319 (-)	1071	WP_044053465.1	competence type IV pilus ATPase ComGA	Machinery gene
ACIGXT_RS12045 (ACIGXT_12045)	-	2482511..2483461 (-)	951	WP_014305415.1	magnesium transporter CorA family protein	-
ACIGXT_RS12050 (ACIGXT_12050)	-	2483607..2484908 (+)	1302	WP_014305416.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16282.81 Da
• Isoelectric Point: 10.3354

>NTDB_id=1070122 ACIGXT_RS12025 WP_044053464.1 2479485..2479922(-) (comGD) [Bacillus velezensis strain Shannan.BV80-12]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1070122 ACIGXT_RS12025 WP_044053464.1 2479485..2479922(-) (comGD) [Bacillus velezensis strain Shannan.BV80-12]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.164	100	0.566