Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ACIGXT_RS12020 Genome accession   NZ_CP173038
Coordinates   2479187..2479501 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain Shannan.BV80-12     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2474187..2484501
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACIGXT_RS11975 (ACIGXT_11975) sinI 2474869..2475042 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACIGXT_RS11980 (ACIGXT_11980) sinR 2475076..2475411 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACIGXT_RS11985 (ACIGXT_11985) tasA 2475459..2476244 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACIGXT_RS11990 (ACIGXT_11990) sipW 2476308..2476892 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACIGXT_RS11995 (ACIGXT_11995) tapA 2476864..2477535 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACIGXT_RS12000 (ACIGXT_12000) - 2477795..2478124 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACIGXT_RS12005 (ACIGXT_12005) - 2478164..2478343 (-) 180 WP_003153093.1 YqzE family protein -
  ACIGXT_RS12010 (ACIGXT_12010) comGG 2478400..2478777 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACIGXT_RS12015 (ACIGXT_12015) comGF 2478778..2479173 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACIGXT_RS12020 (ACIGXT_12020) comGE 2479187..2479501 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACIGXT_RS12025 (ACIGXT_12025) comGD 2479485..2479922 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACIGXT_RS12030 (ACIGXT_12030) comGC 2479912..2480178 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  ACIGXT_RS12035 (ACIGXT_12035) comGB 2480225..2481262 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACIGXT_RS12040 (ACIGXT_12040) comGA 2481249..2482319 (-) 1071 WP_044053465.1 competence type IV pilus ATPase ComGA Machinery gene
  ACIGXT_RS12045 (ACIGXT_12045) - 2482511..2483461 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1070121 ACIGXT_RS12020 WP_015388003.1 2479187..2479501(-) (comGE) [Bacillus velezensis strain Shannan.BV80-12]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1070121 ACIGXT_RS12020 WP_015388003.1 2479187..2479501(-) (comGE) [Bacillus velezensis strain Shannan.BV80-12]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment