Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACIGXT_RS11975 Genome accession   NZ_CP173038
Coordinates   2474869..2475042 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Shannan.BV80-12     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2469869..2480042
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACIGXT_RS11960 (ACIGXT_11960) gcvT 2470687..2471787 (-) 1101 WP_058906182.1 glycine cleavage system aminomethyltransferase GcvT -
  ACIGXT_RS11965 (ACIGXT_11965) - 2472210..2473880 (+) 1671 WP_058906183.1 DEAD/DEAH box helicase -
  ACIGXT_RS11970 (ACIGXT_11970) - 2473898..2474692 (+) 795 WP_003153106.1 YqhG family protein -
  ACIGXT_RS11975 (ACIGXT_11975) sinI 2474869..2475042 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACIGXT_RS11980 (ACIGXT_11980) sinR 2475076..2475411 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACIGXT_RS11985 (ACIGXT_11985) tasA 2475459..2476244 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  ACIGXT_RS11990 (ACIGXT_11990) sipW 2476308..2476892 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACIGXT_RS11995 (ACIGXT_11995) tapA 2476864..2477535 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  ACIGXT_RS12000 (ACIGXT_12000) - 2477795..2478124 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ACIGXT_RS12005 (ACIGXT_12005) - 2478164..2478343 (-) 180 WP_003153093.1 YqzE family protein -
  ACIGXT_RS12010 (ACIGXT_12010) comGG 2478400..2478777 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACIGXT_RS12015 (ACIGXT_12015) comGF 2478778..2479173 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  ACIGXT_RS12020 (ACIGXT_12020) comGE 2479187..2479501 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACIGXT_RS12025 (ACIGXT_12025) comGD 2479485..2479922 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1070118 ACIGXT_RS11975 WP_003153105.1 2474869..2475042(+) (sinI) [Bacillus velezensis strain Shannan.BV80-12]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1070118 ACIGXT_RS11975 WP_003153105.1 2474869..2475042(+) (sinI) [Bacillus velezensis strain Shannan.BV80-12]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment