Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACIGXT_RS11975 | Genome accession | NZ_CP173038 |
| Coordinates | 2474869..2475042 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain Shannan.BV80-12 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2469869..2480042
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACIGXT_RS11960 (ACIGXT_11960) | gcvT | 2470687..2471787 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACIGXT_RS11965 (ACIGXT_11965) | - | 2472210..2473880 (+) | 1671 | WP_058906183.1 | DEAD/DEAH box helicase | - |
| ACIGXT_RS11970 (ACIGXT_11970) | - | 2473898..2474692 (+) | 795 | WP_003153106.1 | YqhG family protein | - |
| ACIGXT_RS11975 (ACIGXT_11975) | sinI | 2474869..2475042 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACIGXT_RS11980 (ACIGXT_11980) | sinR | 2475076..2475411 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACIGXT_RS11985 (ACIGXT_11985) | tasA | 2475459..2476244 (-) | 786 | WP_003153102.1 | biofilm matrix protein TasA | - |
| ACIGXT_RS11990 (ACIGXT_11990) | sipW | 2476308..2476892 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACIGXT_RS11995 (ACIGXT_11995) | tapA | 2476864..2477535 (-) | 672 | WP_024085598.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACIGXT_RS12000 (ACIGXT_12000) | - | 2477795..2478124 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ACIGXT_RS12005 (ACIGXT_12005) | - | 2478164..2478343 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACIGXT_RS12010 (ACIGXT_12010) | comGG | 2478400..2478777 (-) | 378 | WP_014305410.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACIGXT_RS12015 (ACIGXT_12015) | comGF | 2478778..2479173 (-) | 396 | WP_046559876.1 | competence type IV pilus minor pilin ComGF | - |
| ACIGXT_RS12020 (ACIGXT_12020) | comGE | 2479187..2479501 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACIGXT_RS12025 (ACIGXT_12025) | comGD | 2479485..2479922 (-) | 438 | WP_044053464.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1070118 ACIGXT_RS11975 WP_003153105.1 2474869..2475042(+) (sinI) [Bacillus velezensis strain Shannan.BV80-12]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1070118 ACIGXT_RS11975 WP_003153105.1 2474869..2475042(+) (sinI) [Bacillus velezensis strain Shannan.BV80-12]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |