Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ACF1RT_RS01460 Genome accession   NZ_CP172847
Coordinates   291227..291457 (+) Length   76 a.a.
NCBI ID   WP_002265368.1    Uniprot ID   Q8DS95
Organism   Streptococcus mutans strain DPC6143     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 286227..296457
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF1RT_RS01435 (ACF1RT_01435) - 286822..287448 (+) 627 WP_002268642.1 hypothetical protein -
  ACF1RT_RS01440 (ACF1RT_01440) - 287496..288134 (+) 639 WP_002271525.1 VTT domain-containing protein -
  ACF1RT_RS01445 (ACF1RT_01445) comE/blpR 288605..289360 (+) 756 WP_226711110.1 response regulator transcription factor Regulator
  ACF1RT_RS01450 (ACF1RT_01450) comD/blpH 289353..290678 (+) 1326 WP_400260324.1 sensor histidine kinase Regulator
  ACF1RT_RS01455 (ACF1RT_01455) comC/blpC 290820..290960 (-) 141 WP_002267610.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  ACF1RT_RS01460 (ACF1RT_01460) cipB 291227..291457 (+) 231 WP_002265368.1 Blp family class II bacteriocin Regulator
  ACF1RT_RS01465 (ACF1RT_01465) - 291588..291989 (+) 402 WP_002310604.1 hypothetical protein -
  ACF1RT_RS01470 (ACF1RT_01470) - 293370..293789 (+) 420 WP_002263913.1 hypothetical protein -
  ACF1RT_RS01475 (ACF1RT_01475) - 293936..294340 (+) 405 WP_002263912.1 hypothetical protein -
  ACF1RT_RS01480 (ACF1RT_01480) - 294463..294675 (-) 213 Protein_267 IS3 family transposase -
  ACF1RT_RS01485 (ACF1RT_01485) - 295115..295279 (+) 165 WP_002265308.1 hypothetical protein -
  ACF1RT_RS01490 (ACF1RT_01490) - 295663..295875 (+) 213 WP_002263744.1 Blp family class II bacteriocin -
  ACF1RT_RS01495 (ACF1RT_01495) - 296039..296227 (+) 189 WP_400260325.1 Blp family class II bacteriocin -

Sequence


Protein


Download         Length: 76 a.a.        Molecular weight: 7262.08 Da        Isoelectric Point: 3.7781

>NTDB_id=1069070 ACF1RT_RS01460 WP_002265368.1 291227..291457(+) (cipB) [Streptococcus mutans strain DPC6143]
MNTQAFEQFNVMDNEALSAVEGGGRGWNCAAGIALGAGQGYMATAGGTAFLGPYAIGTGAFGAIAGGIGGALNSCG

Nucleotide


Download         Length: 231 bp        

>NTDB_id=1069070 ACF1RT_RS01460 WP_002265368.1 291227..291457(+) (cipB) [Streptococcus mutans strain DPC6143]
ATGAATACACAAGCATTTGAACAATTTAACGTAATGGATAATGAAGCACTTTCAGCTGTTGAAGGTGGGGGCCGCGGATG
GAATTGTGCAGCAGGTATTGCTCTAGGTGCTGGGCAAGGTTATATGGCTACTGCAGGCGGTACAGCATTTCTTGGTCCAT
ATGCTATTGGCACTGGTGCCTTTGGGGCTATTGCTGGAGGAATCGGAGGAGCTCTTAATTCCTGTGGTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q8DS95

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

100

100

1


Multiple sequence alignment