Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ACFMPA_RS12495 Genome accession   NZ_CP172605
Coordinates   2447879..2448262 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus sp. SG20032     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2442879..2453262
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFMPA_RS12455 (ACFMPA_12455) sinI 2443812..2443985 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACFMPA_RS12460 (ACFMPA_12460) sinR 2444019..2444354 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACFMPA_RS12465 (ACFMPA_12465) tasA 2444447..2445232 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ACFMPA_RS12470 (ACFMPA_12470) sipW 2445296..2445868 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACFMPA_RS12475 (ACFMPA_12475) tapA 2445852..2446613 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ACFMPA_RS12480 (ACFMPA_12480) - 2446885..2447211 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACFMPA_RS12485 (ACFMPA_12485) - 2447253..2447432 (-) 180 WP_014480252.1 YqzE family protein -
  ACFMPA_RS12490 (ACFMPA_12490) comGG 2447504..2447878 (-) 375 WP_033884701.1 ComG operon protein ComGG Machinery gene
  ACFMPA_RS12495 (ACFMPA_12495) comGF 2447879..2448262 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  ACFMPA_RS12500 (ACFMPA_12500) comGE 2448288..2448635 (-) 348 WP_033884703.1 ComG operon protein 5 Machinery gene
  ACFMPA_RS12505 (ACFMPA_12505) comGD 2448619..2449050 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  ACFMPA_RS12510 (ACFMPA_12510) comGC 2449040..2449336 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  ACFMPA_RS12515 (ACFMPA_12515) comGB 2449350..2450387 (-) 1038 WP_033884704.1 comG operon protein ComGB Machinery gene
  ACFMPA_RS12520 (ACFMPA_12520) comGA 2450374..2451444 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  ACFMPA_RS12525 (ACFMPA_12525) - 2451672..2451854 (-) 183 WP_033884706.1 hypothetical protein -
  ACFMPA_RS12530 (ACFMPA_12530) corA 2451856..2452809 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=1068227 ACFMPA_RS12495 WP_032726158.1 2447879..2448262(-) (comGF) [Bacillus sp. SG20032]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1068227 ACFMPA_RS12495 WP_032726158.1 2447879..2448262(-) (comGF) [Bacillus sp. SG20032]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992


Multiple sequence alignment