Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACFMPA_RS12455 Genome accession   NZ_CP172605
Coordinates   2443812..2443985 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. SG20032     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2438812..2448985
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFMPA_RS12440 (ACFMPA_12440) gcvT 2439611..2440699 (-) 1089 WP_015251720.1 glycine cleavage system aminomethyltransferase GcvT -
  ACFMPA_RS12445 (ACFMPA_12445) - 2441141..2442814 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  ACFMPA_RS12450 (ACFMPA_12450) - 2442835..2443629 (+) 795 WP_003230200.1 YqhG family protein -
  ACFMPA_RS12455 (ACFMPA_12455) sinI 2443812..2443985 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACFMPA_RS12460 (ACFMPA_12460) sinR 2444019..2444354 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACFMPA_RS12465 (ACFMPA_12465) tasA 2444447..2445232 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  ACFMPA_RS12470 (ACFMPA_12470) sipW 2445296..2445868 (-) 573 WP_003246088.1 signal peptidase I SipW -
  ACFMPA_RS12475 (ACFMPA_12475) tapA 2445852..2446613 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  ACFMPA_RS12480 (ACFMPA_12480) - 2446885..2447211 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACFMPA_RS12485 (ACFMPA_12485) - 2447253..2447432 (-) 180 WP_014480252.1 YqzE family protein -
  ACFMPA_RS12490 (ACFMPA_12490) comGG 2447504..2447878 (-) 375 WP_033884701.1 ComG operon protein ComGG Machinery gene
  ACFMPA_RS12495 (ACFMPA_12495) comGF 2447879..2448262 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  ACFMPA_RS12500 (ACFMPA_12500) comGE 2448288..2448635 (-) 348 WP_033884703.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1068224 ACFMPA_RS12455 WP_003230187.1 2443812..2443985(+) (sinI) [Bacillus sp. SG20032]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1068224 ACFMPA_RS12455 WP_003230187.1 2443812..2443985(+) (sinI) [Bacillus sp. SG20032]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment