Detailed information NTG1066515

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACH2FV_RS11415
• Genome accession: NZ_CP172339
• Coordinates: 2231221..2231514 (-)
• Length: 97 a.a.
• NCBI ID: WP_024422977.1
• Uniprot ID: A0A0M2EIN6
• Organism: Bacillus safensis subsp. safensis strain KGU003
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2226221..2236514

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACH2FV_RS11365 (ACH2FV_11365)	sinR	2226385..2226720 (+)	336	WP_087975811.1	transcriptional regulator SinR	Regulator
ACH2FV_RS11370 (ACH2FV_11370)	tasA	2226788..2227588 (-)	801	WP_076840976.1	biofilm matrix protein TasA	-
ACH2FV_RS11375 (ACH2FV_11375)	sipW	2227646..2228218 (-)	573	WP_041106855.1	signal peptidase I SipW	-
ACH2FV_RS11380 (ACH2FV_11380)	tapA	2228271..2228798 (-)	528	WP_076840975.1	amyloid fiber anchoring/assembly protein TapA	-
ACH2FV_RS11385 (ACH2FV_11385)	-	2229099..2229377 (+)	279	WP_249895874.1	DUF3889 domain-containing protein	-
ACH2FV_RS11390 (ACH2FV_11390)	-	2229411..2229605 (-)	195	WP_024718846.1	YqzE family protein	-
ACH2FV_RS11395 (ACH2FV_11395)	-	2229665..2230048 (-)	384	WP_103131951.1	competence type IV pilus minor pilin ComGG	-
ACH2FV_RS11400 (ACH2FV_11400)	comGF	2230045..2230572 (-)	528	WP_395893902.1	competence type IV pilus minor pilin ComGF	-
ACH2FV_RS11405 (ACH2FV_11405)	comGE	2230484..2230798 (-)	315	WP_041106865.1	competence type IV pilus minor pilin ComGE	-
ACH2FV_RS11410 (ACH2FV_11410)	comGD	2230782..2231228 (-)	447	WP_041106867.1	competence type IV pilus minor pilin ComGD	-
ACH2FV_RS11415 (ACH2FV_11415)	comGC	2231221..2231514 (-)	294	WP_024422977.1	competence type IV pilus major pilin ComGC	Machinery gene
ACH2FV_RS11420 (ACH2FV_11420)	comGB	2231531..2232571 (-)	1041	WP_034280202.1	competence type IV pilus assembly protein ComGB	-
ACH2FV_RS11425 (ACH2FV_11425)	comGA	2232552..2233622 (-)	1071	WP_076840973.1	competence type IV pilus ATPase ComGA	Machinery gene
ACH2FV_RS11430 (ACH2FV_11430)	-	2233800..2234675 (-)	876	WP_056767330.1	STAS domain-containing protein	-
ACH2FV_RS11440 (ACH2FV_11440)	-	2234899..2235279 (-)	381	WP_007501232.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
ACH2FV_RS11445 (ACH2FV_11445)	-	2235492..2235734 (+)	243	WP_003217440.1	DUF2626 domain-containing protein	-
ACH2FV_RS11450 (ACH2FV_11450)	-	2235781..2236419 (-)	639	WP_395893903.1	MBL fold metallo-hydrolase	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 10686.62 Da
• Isoelectric Point: 7.3218

>NTDB_id=1066515 ACH2FV_RS11415 WP_024422977.1 2231221..2231514(-) (comGC) [Bacillus safensis subsp. safensis strain KGU003]
MNDKGFTLLEMLIVMLVISILLLITIPNITRHHQAIQAKGCEGLKSMVSTQVMAYELEHDGKTPSLAELEKEGYVKKGLT
CPNGKAIVIQNGNVKHE

Nucleotide

• Length: 294 bp

>NTDB_id=1066515 ACH2FV_RS11415 WP_024422977.1 2231221..2231514(-) (comGC) [Bacillus safensis subsp. safensis strain KGU003]
ATGAATGATAAAGGATTTACCCTGTTAGAAATGTTAATAGTCATGCTCGTAATATCCATTCTTTTACTCATTACCATACC
AAATATCACACGTCATCACCAAGCTATTCAGGCAAAGGGCTGTGAAGGGCTTAAATCAATGGTCAGCACACAAGTGATGG
CATATGAATTGGAGCATGATGGGAAGACGCCATCTTTAGCTGAATTAGAAAAAGAAGGTTATGTCAAAAAGGGGTTAACT
TGTCCTAATGGAAAAGCGATTGTCATTCAAAACGGCAACGTGAAGCATGAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (2-25)

3D structure

• AlphaFold DB: A0A0M2EIN6

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	67.01	100	0.67
comGC	Staphylococcus aureus MW2	42.222	92.784	0.392
comGC	Staphylococcus aureus N315	42.222	92.784	0.392