Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACHW6Z_RS13805 Genome accession   NZ_CP172123
Coordinates   3030255..3030725 (+) Length   156 a.a.
NCBI ID   WP_395601047.1    Uniprot ID   -
Organism   Providencia rettgeri strain M-D3G1-2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2981574..3034278 3030255..3030725 within 0


Gene organization within MGE regions


Location: 2981574..3034278
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACHW6Z_RS13470 - 2981574..2983505 (+) 1932 WP_272673668.1 type I secretion system permease/ATPase -
  ACHW6Z_RS13475 - 2984079..2984486 (-) 408 WP_395601015.1 transcriptional regulator -
  ACHW6Z_RS13480 - 2984495..2984860 (-) 366 WP_349482107.1 DUF6516 family protein -
  ACHW6Z_RS13485 - 2985201..2986118 (-) 918 WP_395601016.1 phage antirepressor N-terminal domain-containing protein -
  ACHW6Z_RS13490 - 2986188..2986346 (-) 159 WP_144141777.1 Arc family DNA-binding protein -
  ACHW6Z_RS13495 - 2986461..2986706 (+) 246 WP_131679895.1 Arc family DNA-binding protein -
  ACHW6Z_RS13500 - 2986756..2988495 (+) 1740 WP_395601017.1 AAA family ATPase -
  ACHW6Z_RS13505 - 2988562..2989422 (+) 861 WP_395601018.1 DNA adenine methylase -
  ACHW6Z_RS13510 - 2989515..2989886 (-) 372 WP_395601019.1 hypothetical protein -
  ACHW6Z_RS13515 - 2990082..2991230 (+) 1149 WP_395601020.1 hypothetical protein -
  ACHW6Z_RS13520 - 2991273..2993294 (-) 2022 WP_395601021.1 hypothetical protein -
  ACHW6Z_RS13525 - 2993356..2995830 (-) 2475 WP_395601022.1 host specificity factor TipJ family phage tail protein -
  ACHW6Z_RS13530 - 2995817..2996209 (-) 393 WP_395601023.1 NlpC/P60 family protein -
  ACHW6Z_RS13535 - 2996209..2996643 (-) 435 WP_349483419.1 DUF1833 family protein -
  ACHW6Z_RS13540 - 2996673..2997158 (-) 486 WP_272693503.1 hypothetical protein -
  ACHW6Z_RS13545 - 2997283..2997576 (+) 294 WP_272693502.1 DUF1883 domain-containing protein -
  ACHW6Z_RS13550 - 2997556..2997735 (-) 180 WP_210789348.1 Rrf2 family transcriptional regulator -
  ACHW6Z_RS13555 - 2997748..3000975 (-) 3228 WP_395601024.1 tape measure protein -
  ACHW6Z_RS13560 - 3001486..3002172 (-) 687 WP_349482114.1 DUF6246 family protein -
  ACHW6Z_RS13565 - 3002221..3002976 (-) 756 WP_395601025.1 phage tail tube protein -
  ACHW6Z_RS13570 - 3003045..3003413 (-) 369 WP_395601026.1 hypothetical protein -
  ACHW6Z_RS13575 - 3003410..3003847 (-) 438 WP_395601027.1 HK97 gp10 family phage protein -
  ACHW6Z_RS13580 - 3003849..3004217 (-) 369 WP_395601028.1 hypothetical protein -
  ACHW6Z_RS13585 - 3004214..3004585 (-) 372 WP_136135542.1 hypothetical protein -
  ACHW6Z_RS13590 - 3004569..3004778 (-) 210 WP_395601029.1 hypothetical protein -
  ACHW6Z_RS13595 - 3004788..3005852 (-) 1065 WP_395601030.1 major capsid protein -
  ACHW6Z_RS13600 - 3005863..3006303 (-) 441 WP_126437294.1 hypothetical protein -
  ACHW6Z_RS13605 - 3006307..3007683 (-) 1377 WP_395601031.1 DUF2213 domain-containing protein -
  ACHW6Z_RS13610 - 3007702..3007953 (-) 252 WP_210848410.1 hypothetical protein -
  ACHW6Z_RS13615 - 3007953..3008960 (-) 1008 WP_349482118.1 phage minor head protein -
  ACHW6Z_RS13620 - 3008914..3010356 (-) 1443 WP_349483400.1 anti-CBASS protein Acb1 family protein -
  ACHW6Z_RS13625 - 3010369..3011664 (-) 1296 WP_349482120.1 phage terminase large subunit -
  ACHW6Z_RS13630 - 3011648..3012073 (-) 426 WP_096864261.1 terminase small subunit -
  ACHW6Z_RS13635 - 3012132..3012389 (-) 258 WP_349487211.1 DUF2560 family protein -
  ACHW6Z_RS13640 - 3012524..3012760 (-) 237 WP_349482122.1 hypothetical protein -
  ACHW6Z_RS13645 - 3012980..3013747 (-) 768 WP_349482123.1 KilA-N domain-containing protein -
  ACHW6Z_RS13650 - 3014068..3014292 (-) 225 WP_349487212.1 hypothetical protein -
  ACHW6Z_RS13655 - 3014292..3014741 (-) 450 WP_349487537.1 lysis protein -
  ACHW6Z_RS13660 - 3014743..3015225 (-) 483 WP_395601032.1 TIGR02594 family protein -
  ACHW6Z_RS13665 - 3015218..3015535 (-) 318 WP_198861227.1 phage holin, lambda family -
  ACHW6Z_RS13670 - 3015634..3015930 (-) 297 WP_226693965.1 DUF4406 domain-containing protein -
  ACHW6Z_RS13675 - 3016179..3016562 (-) 384 WP_140180797.1 antiterminator Q family protein -
  ACHW6Z_RS13680 - 3017041..3017634 (-) 594 WP_395601033.1 recombination protein NinG -
  ACHW6Z_RS13685 - 3017695..3018069 (-) 375 WP_349482127.1 hypothetical protein -
  ACHW6Z_RS13690 - 3018191..3018373 (-) 183 WP_349482128.1 hypothetical protein -
  ACHW6Z_RS13695 - 3018370..3018813 (-) 444 WP_349482129.1 recombination protein NinB -
  ACHW6Z_RS13700 - 3018823..3019074 (-) 252 WP_349482130.1 DUF4752 family protein -
  ACHW6Z_RS13705 - 3019067..3019240 (-) 174 WP_395601034.1 Lar family restriction alleviation protein -
  ACHW6Z_RS13710 - 3019241..3019450 (-) 210 WP_395606182.1 hypothetical protein -
  ACHW6Z_RS13715 - 3019485..3019754 (-) 270 WP_395601035.1 hypothetical protein -
  ACHW6Z_RS13720 - 3019772..3019984 (-) 213 WP_154601188.1 Lar family restriction alleviation protein -
  ACHW6Z_RS13725 - 3020010..3021380 (-) 1371 WP_395601036.1 replicative DNA helicase -
  ACHW6Z_RS13730 - 3021383..3022303 (-) 921 WP_395601037.1 replication protein -
  ACHW6Z_RS13735 - 3022296..3022421 (-) 126 WP_255254512.1 hypothetical protein -
  ACHW6Z_RS13740 - 3022512..3022859 (-) 348 WP_395601038.1 hypothetical protein -
  ACHW6Z_RS13745 - 3022965..3023174 (-) 210 WP_006657610.1 helix-turn-helix transcriptional regulator -
  ACHW6Z_RS13750 - 3023282..3023926 (+) 645 WP_349483390.1 LexA family transcriptional regulator -
  ACHW6Z_RS13755 - 3024048..3024182 (+) 135 WP_395601039.1 hypothetical protein -
  ACHW6Z_RS13760 - 3024197..3025150 (+) 954 WP_395601040.1 hypothetical protein -
  ACHW6Z_RS13765 - 3025513..3025827 (+) 315 WP_395601041.1 hypothetical protein -
  ACHW6Z_RS13770 - 3025864..3027228 (+) 1365 WP_395601042.1 hypothetical protein -
  ACHW6Z_RS13775 - 3027351..3027590 (+) 240 WP_395606121.1 hypothetical protein -
  ACHW6Z_RS13780 - 3027896..3028123 (+) 228 WP_395601044.1 hypothetical protein -
  ACHW6Z_RS13785 - 3028125..3028388 (+) 264 WP_109911113.1 hypothetical protein -
  ACHW6Z_RS13790 - 3028605..3028871 (+) 267 WP_048606419.1 hypothetical protein -
  ACHW6Z_RS13795 - 3029013..3029366 (+) 354 WP_395601045.1 hypothetical protein -
  ACHW6Z_RS13800 - 3029382..3030254 (+) 873 WP_395601046.1 ATP-binding protein -
  ACHW6Z_RS13805 ssb 3030255..3030725 (+) 471 WP_395601047.1 single-stranded DNA-binding protein Machinery gene
  ACHW6Z_RS13810 - 3030738..3031292 (+) 555 WP_349483382.1 hypothetical protein -
  ACHW6Z_RS13815 - 3031648..3031932 (+) 285 WP_272517748.1 hypothetical protein -
  ACHW6Z_RS13820 - 3031929..3032444 (+) 516 WP_349483381.1 hypothetical protein -
  ACHW6Z_RS13825 - 3032444..3032737 (+) 294 WP_349483380.1 cyclic-phosphate processing receiver domain-containing protein -
  ACHW6Z_RS13830 - 3033232..3034278 (+) 1047 WP_395601048.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17513.55 Da        Isoelectric Point: 7.2020

>NTDB_id=1065397 ACHW6Z_RS13805 WP_395601047.1 3030255..3030725(+) (ssb) [Providencia rettgeri strain M-D3G1-2]
MAERGVNKSIILGNLGDDPNVRYSPNGTAFANFSVATSETWRDKNTGEKRERTDWHNIVIQGKLAEVAGQYLKKGSQVYI
EGKMRTRKYQGNDGQDKYITEVIVGIDGKMQMLGSGNQTEVQNPKPSTQGIQRPQHQPKTQQPETPLDFDDDMIPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1065397 ACHW6Z_RS13805 WP_395601047.1 3030255..3030725(+) (ssb) [Providencia rettgeri strain M-D3G1-2]
ATGGCAGAGAGAGGCGTCAATAAATCCATCATTCTAGGAAATTTAGGCGATGATCCGAACGTGAGGTATTCACCGAACGG
AACCGCATTTGCTAATTTCTCAGTTGCTACAAGTGAAACGTGGAGAGATAAAAATACAGGAGAGAAGCGAGAACGCACTG
ATTGGCATAATATTGTTATACAAGGAAAATTAGCTGAAGTAGCAGGCCAGTACCTGAAAAAAGGGAGTCAGGTATACATA
GAGGGAAAAATGCGTACTCGTAAGTATCAAGGTAATGACGGTCAGGATAAGTACATTACCGAGGTCATCGTTGGCATTGA
TGGAAAAATGCAAATGCTAGGCAGCGGTAATCAGACTGAAGTTCAGAACCCGAAGCCATCAACTCAGGGAATTCAGCGCC
CACAACACCAACCGAAAACTCAACAACCTGAGACACCATTAGATTTTGACGACGATATGATCCCGTTTTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

54.144

100

0.628

  ssb Glaesserella parasuis strain SC1401

48.066

100

0.558

  ssb Neisseria meningitidis MC58

44.318

100

0.5

  ssb Neisseria gonorrhoeae MS11

48.63

93.59

0.455


Multiple sequence alignment