Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ACHV18_RS03685 | Genome accession | NZ_CP172051 |
| Coordinates | 772555..773019 (+) | Length | 154 a.a. |
| NCBI ID | WP_238300544.1 | Uniprot ID | - |
| Organism | Pasteurella multocida strain 103220 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 729838..779232 | 772555..773019 | within | 0 |
Gene organization within MGE regions
Location: 729838..779232
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACHV18_RS03395 (ACHV18_03395) | folE | 729838..730494 (-) | 657 | WP_005726594.1 | GTP cyclohydrolase I FolE | - |
| ACHV18_RS03400 (ACHV18_03400) | - | 730881..731204 (-) | 324 | WP_014390761.1 | hypothetical protein | - |
| ACHV18_RS03405 (ACHV18_03405) | - | 731252..737131 (-) | 5880 | WP_395506318.1 | phage tail protein | - |
| ACHV18_RS03410 (ACHV18_03410) | - | 737135..737755 (-) | 621 | WP_014667799.1 | tail assembly protein | - |
| ACHV18_RS03415 (ACHV18_03415) | - | 737698..738441 (-) | 744 | WP_395506319.1 | C40 family peptidase | - |
| ACHV18_RS03420 (ACHV18_03420) | - | 738446..739159 (-) | 714 | WP_319047058.1 | phage minor tail protein L | - |
| ACHV18_RS03425 (ACHV18_03425) | - | 739249..739578 (-) | 330 | WP_014390756.1 | phage tail protein | - |
| ACHV18_RS03430 (ACHV18_03430) | - | 739581..742025 (-) | 2445 | WP_238300305.1 | phage tail length tape measure family protein | - |
| ACHV18_RS03435 (ACHV18_03435) | - | 742077..742901 (-) | 825 | WP_071523791.1 | phage antirepressor N-terminal domain-containing protein | - |
| ACHV18_RS03440 (ACHV18_03440) | - | 743240..744058 (+) | 819 | WP_014390752.1 | hypothetical protein | - |
| ACHV18_RS03445 (ACHV18_03445) | - | 744134..744490 (-) | 357 | WP_014390751.1 | TM2 domain-containing protein | - |
| ACHV18_RS03450 (ACHV18_03450) | - | 744567..745238 (-) | 672 | WP_016533320.1 | DUF6246 family protein | - |
| ACHV18_RS03455 (ACHV18_03455) | - | 745292..745774 (-) | 483 | WP_014390749.1 | phage tail tube protein | - |
| ACHV18_RS03460 (ACHV18_03460) | - | 745786..746157 (-) | 372 | WP_016533319.1 | hypothetical protein | - |
| ACHV18_RS03465 (ACHV18_03465) | - | 746154..746525 (-) | 372 | WP_014390747.1 | hypothetical protein | - |
| ACHV18_RS03470 (ACHV18_03470) | - | 746530..746874 (-) | 345 | WP_014390746.1 | hypothetical protein | - |
| ACHV18_RS03475 (ACHV18_03475) | - | 746877..747245 (-) | 369 | WP_042743192.1 | hypothetical protein | - |
| ACHV18_RS03480 (ACHV18_03480) | - | 747226..747639 (-) | 414 | WP_081317748.1 | hypothetical protein | - |
| ACHV18_RS03485 (ACHV18_03485) | - | 747650..748648 (-) | 999 | WP_016533288.1 | major capsid protein | - |
| ACHV18_RS03490 (ACHV18_03490) | - | 748660..749094 (-) | 435 | WP_016533289.1 | hypothetical protein | - |
| ACHV18_RS03495 (ACHV18_03495) | - | 749094..750440 (-) | 1347 | WP_016533290.1 | hypothetical protein | - |
| ACHV18_RS03500 (ACHV18_03500) | - | 750455..751426 (-) | 972 | WP_014390740.1 | phage minor head protein | - |
| ACHV18_RS03505 (ACHV18_03505) | - | 751380..752825 (-) | 1446 | WP_016533291.1 | anti-CBASS protein Acb1 family protein | - |
| ACHV18_RS03510 (ACHV18_03510) | - | 752840..754066 (-) | 1227 | WP_016533292.1 | PBSX family phage terminase large subunit | - |
| ACHV18_RS03515 (ACHV18_03515) | - | 754050..754547 (-) | 498 | WP_014390737.1 | terminase | - |
| ACHV18_RS03520 (ACHV18_03520) | - | 754630..754812 (+) | 183 | WP_016533497.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACHV18_RS03525 (ACHV18_03525) | - | 754841..755275 (+) | 435 | WP_014390736.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACHV18_RS03530 (ACHV18_03530) | - | 755310..755519 (-) | 210 | WP_023430090.1 | hypothetical protein | - |
| ACHV18_RS03535 (ACHV18_03535) | - | 755497..755820 (-) | 324 | WP_016569983.1 | DUF2570 family protein | - |
| ACHV18_RS03540 (ACHV18_03540) | - | 755823..756407 (-) | 585 | WP_016533462.1 | glycoside hydrolase family 19 protein | - |
| ACHV18_RS03545 (ACHV18_03545) | - | 756379..756744 (-) | 366 | WP_016533461.1 | phage holin, lambda family | - |
| ACHV18_RS03550 (ACHV18_03550) | - | 756958..757143 (-) | 186 | WP_143930513.1 | hypothetical protein | - |
| ACHV18_RS03555 (ACHV18_03555) | - | 757333..757698 (-) | 366 | WP_016533470.1 | antiterminator Q family protein | - |
| ACHV18_RS03560 (ACHV18_03560) | - | 757698..758300 (-) | 603 | WP_395506320.1 | recombination protein NinG | - |
| ACHV18_RS03565 (ACHV18_03565) | - | 758388..758600 (-) | 213 | WP_016533468.1 | hypothetical protein | - |
| ACHV18_RS03570 (ACHV18_03570) | - | 758674..759132 (-) | 459 | WP_016569985.1 | recombination protein NinB | - |
| ACHV18_RS03575 (ACHV18_03575) | - | 759122..759658 (-) | 537 | WP_014391470.1 | phage N-6-adenine-methyltransferase | - |
| ACHV18_RS03580 (ACHV18_03580) | - | 759662..760351 (-) | 690 | WP_016533441.1 | replication protein P | - |
| ACHV18_RS03585 (ACHV18_03585) | - | 760351..761253 (-) | 903 | WP_016533442.1 | hypothetical protein | - |
| ACHV18_RS03590 (ACHV18_03590) | - | 761255..761608 (-) | 354 | WP_014390722.1 | HNH endonuclease | - |
| ACHV18_RS03595 (ACHV18_03595) | - | 761685..761865 (-) | 181 | Protein_679 | hypothetical protein | - |
| ACHV18_RS03600 (ACHV18_03600) | - | 761917..762051 (-) | 135 | WP_016569987.1 | hypothetical protein | - |
| ACHV18_RS03605 (ACHV18_03605) | - | 762116..762568 (-) | 453 | WP_102822910.1 | phage regulatory CII family protein | - |
| ACHV18_RS03610 (ACHV18_03610) | - | 762617..762817 (-) | 201 | WP_075266297.1 | YdaS family helix-turn-helix protein | - |
| ACHV18_RS03615 (ACHV18_03615) | - | 762939..763625 (+) | 687 | WP_075266295.1 | helix-turn-helix transcriptional regulator | - |
| ACHV18_RS03620 (ACHV18_03620) | - | 763701..764438 (+) | 738 | WP_014390717.1 | HipA family kinase | - |
| ACHV18_RS03625 (ACHV18_03625) | - | 764435..765259 (+) | 825 | WP_014390716.1 | DUF3037 domain-containing protein | - |
| ACHV18_RS03630 (ACHV18_03630) | - | 765768..765995 (+) | 228 | WP_099868513.1 | hypothetical protein | - |
| ACHV18_RS03635 (ACHV18_03635) | - | 766404..767933 (+) | 1530 | WP_228767747.1 | SIR2 family protein | - |
| ACHV18_RS03640 (ACHV18_03640) | - | 768030..768293 (+) | 264 | WP_014391456.1 | hypothetical protein | - |
| ACHV18_RS03645 (ACHV18_03645) | - | 768381..768914 (+) | 534 | WP_014391102.1 | hypothetical protein | - |
| ACHV18_RS03650 (ACHV18_03650) | - | 768915..769040 (-) | 126 | WP_014391103.1 | hypothetical protein | - |
| ACHV18_RS03655 (ACHV18_03655) | - | 769385..770062 (+) | 678 | WP_075266291.1 | BRO family protein | - |
| ACHV18_RS03660 (ACHV18_03660) | - | 770147..770446 (+) | 300 | WP_014390709.1 | hypothetical protein | - |
| ACHV18_RS03665 (ACHV18_03665) | - | 770418..770654 (+) | 237 | WP_075266289.1 | hypothetical protein | - |
| ACHV18_RS03670 (ACHV18_03670) | - | 770667..770954 (+) | 288 | WP_064964850.1 | hypothetical protein | - |
| ACHV18_RS03675 (ACHV18_03675) | - | 770956..771909 (+) | 954 | WP_014391451.1 | recombinase RecT | - |
| ACHV18_RS03680 (ACHV18_03680) | - | 771881..772555 (+) | 675 | WP_015691053.1 | translocation protein TolB precursor | - |
| ACHV18_RS03685 (ACHV18_03685) | ssb | 772555..773019 (+) | 465 | WP_238300544.1 | single-stranded DNA-binding protein | Machinery gene |
| ACHV18_RS03690 (ACHV18_03690) | - | 773031..773222 (+) | 192 | WP_016533530.1 | hypothetical protein | - |
| ACHV18_RS03695 (ACHV18_03695) | - | 773265..773618 (+) | 354 | WP_016570064.1 | hypothetical protein | - |
| ACHV18_RS03700 (ACHV18_03700) | - | 773690..774478 (+) | 789 | WP_014391448.1 | DUF2303 family protein | - |
| ACHV18_RS03705 (ACHV18_03705) | - | 774529..775128 (+) | 600 | WP_016569996.1 | hypothetical protein | - |
| ACHV18_RS03710 (ACHV18_03710) | - | 775125..775691 (+) | 567 | WP_238300221.1 | DUF551 domain-containing protein | - |
| ACHV18_RS03715 (ACHV18_03715) | - | 775703..776191 (+) | 489 | WP_238300220.1 | DUF551 domain-containing protein | - |
| ACHV18_RS03720 (ACHV18_03720) | - | 776200..776556 (+) | 357 | WP_071523850.1 | hypothetical protein | - |
| ACHV18_RS03725 (ACHV18_03725) | - | 776601..776903 (+) | 303 | WP_075266283.1 | hypothetical protein | - |
| ACHV18_RS03730 (ACHV18_03730) | - | 777050..777349 (+) | 300 | WP_071523556.1 | hypothetical protein | - |
| ACHV18_RS03735 (ACHV18_03735) | - | 777435..777890 (+) | 456 | WP_071523557.1 | pyruvate kinase | - |
| ACHV18_RS03740 (ACHV18_03740) | - | 777965..778246 (+) | 282 | WP_071523558.1 | hypothetical protein | - |
| ACHV18_RS03745 (ACHV18_03745) | - | 778243..779232 (-) | 990 | WP_075266281.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 154 a.a. Molecular weight: 17177.96 Da Isoelectric Point: 5.9165
>NTDB_id=1064912 ACHV18_RS03685 WP_238300544.1 772555..773019(+) (ssb) [Pasteurella multocida strain 103220]
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
MAGVNKVIIVGNLGNDPEIRTMPNGEAVANISVATSESWIDKNTGERKTQTEWHSIVFYRRQAEICGQYLKKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRQDSQAQANAQANAQAPQNNAYANAKAGKPVQQADSFEDDSIPF
Nucleotide
Download Length: 465 bp
>NTDB_id=1064912 ACHV18_RS03685 WP_238300544.1 772555..773019(+) (ssb) [Pasteurella multocida strain 103220]
ATGGCTGGAGTCAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGATAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA
ATGGCTGGAGTCAATAAAGTAATTATTGTAGGAAACTTAGGTAACGATCCTGAAATCCGCACAATGCCAAATGGTGAAGC
CGTAGCCAATATCAGTGTCGCCACAAGCGAAAGTTGGATCGACAAAAATACTGGCGAACGAAAAACACAAACTGAATGGC
ATTCTATCGTGTTCTATCGTCGCCAAGCAGAAATTTGCGGTCAGTATCTCAAAAAAGGATCGAAAGTGTATGTGGAAGGG
CGTTTAAGAACTCGTAAATGGCAAGACCAAAACGGGCAAGACCGCTACACCACTGAAATCCAAGGCGACGTATTGCAGAT
GTTAGATAGTCGCCAAGATTCACAAGCACAAGCTAACGCACAAGCTAACGCACAAGCACCGCAAAACAATGCTTATGCCA
ATGCGAAAGCTGGAAAGCCAGTGCAACAGGCTGATAGTTTTGAAGATGATAGCATACCTTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.431 |
100 |
0.734 |
| ssb | Vibrio cholerae strain A1552 |
49.425 |
100 |
0.558 |
| ssb | Neisseria meningitidis MC58 |
44.509 |
100 |
0.5 |
| ssb | Neisseria gonorrhoeae MS11 |
44.509 |
100 |
0.5 |