Detailed information
Overview
| Name | comW | Type | Regulator |
| Locus tag | AABA14_RS00115 | Genome accession | NZ_AP028607 |
| Coordinates | 22173..22409 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939546.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain Sep2 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 12174..74427 | 22173..22409 | within | 0 |
Gene organization within MGE regions
Location: 12174..74427
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABA14_RS00065 (TKY123642_00130) | ftsH | 12174..14132 (+) | 1959 | WP_000744557.1 | ATP-dependent zinc metalloprotease FtsH | - |
| AABA14_RS00070 (TKY123642_00140) | comX/comX2 | 14254..14733 (+) | 480 | WP_000588897.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| AABA14_RS00105 | - | 20238..21076 (+) | 839 | Protein_14 | IS630 family transposase | - |
| AABA14_RS00110 | - | 21136..21908 (-) | 773 | Protein_15 | transposase | - |
| AABA14_RS00115 (TKY123642_00150) | comW | 22173..22409 (+) | 237 | WP_000939546.1 | sigma(X)-activator ComW | Regulator |
| AABA14_RS00120 (TKY123642_00160) | - | 22640..23926 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| AABA14_RS00125 (TKY123642_00170) | - | 24168..25316 (-) | 1149 | WP_000876735.1 | site-specific integrase | - |
| AABA14_RS00130 (TKY123642_00180) | - | 25488..26402 (-) | 915 | WP_317680939.1 | HIRAN domain-containing protein | - |
| AABA14_RS00135 (TKY123642_00190) | - | 26415..27149 (-) | 735 | WP_001100508.1 | S24 family peptidase | - |
| AABA14_RS00140 (TKY123642_00200) | - | 27315..27530 (+) | 216 | WP_000248658.1 | helix-turn-helix domain-containing protein | - |
| AABA14_RS00145 (TKY123642_00210) | - | 27558..28268 (+) | 711 | WP_024475412.1 | ORF6C domain-containing protein | - |
| AABA14_RS00150 (TKY123642_00220) | - | 28282..28539 (+) | 258 | WP_000370958.1 | hypothetical protein | - |
| AABA14_RS00155 (TKY123642_00230) | - | 28625..28945 (+) | 321 | WP_000462824.1 | hypothetical protein | - |
| AABA14_RS00160 (TKY123642_00240) | - | 28961..29257 (+) | 297 | WP_000391805.1 | hypothetical protein | - |
| AABA14_RS00165 (TKY123642_00250) | - | 29250..30083 (+) | 834 | WP_024475411.1 | phage replisome organizer N-terminal domain-containing protein | - |
| AABA14_RS00170 (TKY123642_00260) | - | 30071..30229 (+) | 159 | WP_168952850.1 | hypothetical protein | - |
| AABA14_RS00175 (TKY123642_00270) | - | 30223..30993 (+) | 771 | WP_050203373.1 | ATP-binding protein | - |
| AABA14_RS00180 (TKY123642_00280) | - | 31008..31202 (+) | 195 | WP_000470303.1 | hypothetical protein | - |
| AABA14_RS00185 (TKY123642_00290) | - | 31202..31429 (+) | 228 | WP_000891969.1 | hypothetical protein | - |
| AABA14_RS00190 (TKY123642_00300) | - | 31556..31720 (+) | 165 | WP_000233201.1 | hypothetical protein | - |
| AABA14_RS00195 (TKY123642_00310) | - | 31710..31919 (+) | 210 | WP_001105098.1 | hypothetical protein | - |
| AABA14_RS00200 (TKY123642_00320) | - | 31891..32208 (+) | 318 | WP_000969662.1 | hypothetical protein | - |
| AABA14_RS00205 (TKY123642_00330) | - | 32210..32719 (+) | 510 | WP_001041150.1 | DUF1642 domain-containing protein | - |
| AABA14_RS00210 (TKY123642_00340) | - | 32712..33311 (+) | 600 | WP_050201990.1 | DUF1642 domain-containing protein | - |
| AABA14_RS00215 (TKY123642_00350) | - | 33311..33598 (+) | 288 | WP_000194862.1 | hypothetical protein | - |
| AABA14_RS00220 (TKY123642_00360) | - | 33598..33786 (+) | 189 | WP_001277861.1 | hypothetical protein | - |
| AABA14_RS00225 | - | 33865..33966 (+) | 102 | Protein_38 | DUF3310 domain-containing protein | - |
| AABA14_RS00230 (TKY123642_00380) | - | 33959..34138 (+) | 180 | WP_000005958.1 | hypothetical protein | - |
| AABA14_RS00235 (TKY123642_00390) | - | 34128..34358 (+) | 231 | WP_000653364.1 | helix-turn-helix transcriptional regulator | - |
| AABA14_RS00240 (TKY123642_00400) | - | 34430..34858 (+) | 429 | WP_001165368.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AABA14_RS00245 (TKY123642_00410) | - | 35147..35713 (+) | 567 | WP_000754954.1 | site-specific integrase | - |
| AABA14_RS00250 (TKY123642_00420) | - | 35947..36291 (+) | 345 | WP_001095652.1 | HNH endonuclease signature motif containing protein | - |
| AABA14_RS00255 (TKY123642_00430) | - | 36430..37734 (+) | 1305 | WP_000172766.1 | hypothetical protein | - |
| AABA14_RS00260 (TKY123642_00440) | - | 37688..39079 (+) | 1392 | WP_000228948.1 | hypothetical protein | - |
| AABA14_RS00265 (TKY123642_00450) | - | 39069..39308 (+) | 240 | WP_000834150.1 | hypothetical protein | - |
| AABA14_RS00270 (TKY123642_00460) | - | 39361..39591 (+) | 231 | WP_000528517.1 | hypothetical protein | - |
| AABA14_RS00275 (TKY123642_00470) | - | 39642..41054 (+) | 1413 | WP_000101485.1 | terminase | - |
| AABA14_RS00280 (TKY123642_00480) | - | 41136..41600 (+) | 465 | WP_001288685.1 | DUF4355 domain-containing protein | - |
| AABA14_RS00285 (TKY123642_00490) | - | 41606..42505 (+) | 900 | WP_000774646.1 | phage major capsid protein | - |
| AABA14_RS00290 (TKY123642_00500) | - | 42511..42723 (+) | 213 | WP_001240369.1 | HeH/LEM domain-containing protein | - |
| AABA14_RS00295 (TKY123642_00510) | - | 42727..43167 (+) | 441 | WP_000526245.1 | phage Gp19/Gp15/Gp42 family protein | - |
| AABA14_RS00300 (TKY123642_00520) | - | 43112..43450 (+) | 339 | WP_000221695.1 | hypothetical protein | - |
| AABA14_RS00305 (TKY123642_00530) | - | 43452..43679 (+) | 228 | WP_001852278.1 | hypothetical protein | - |
| AABA14_RS00310 (TKY123642_00540) | - | 43676..44011 (+) | 336 | WP_000571659.1 | hypothetical protein | - |
| AABA14_RS00315 (TKY123642_00550) | - | 44078..44635 (+) | 558 | WP_033683240.1 | hypothetical protein | - |
| AABA14_RS00320 (TKY123642_00560) | - | 44641..44916 (+) | 276 | WP_000387407.1 | hypothetical protein | - |
| AABA14_RS00325 (TKY123642_00570) | - | 44928..45314 (+) | 387 | WP_000560881.1 | DUF5361 domain-containing protein | - |
| AABA14_RS00330 (TKY123642_00580) | - | 45314..47779 (+) | 2466 | WP_000179968.1 | hypothetical protein | - |
| AABA14_RS00335 (TKY123642_00590) | - | 47779..48477 (+) | 699 | WP_000499607.1 | adenylosuccinate synthetase | - |
| AABA14_RS00340 (TKY123642_00600) | - | 48474..57497 (+) | 9024 | WP_317680943.1 | phage tail spike protein | - |
| AABA14_RS00345 | - | 57494..57610 (+) | 117 | WP_001063632.1 | hypothetical protein | - |
| AABA14_RS00350 (TKY123642_00610) | - | 57591..57794 (+) | 204 | WP_001091112.1 | hypothetical protein | - |
| AABA14_RS00355 (TKY123642_00620) | - | 57797..58147 (+) | 351 | WP_000852244.1 | hypothetical protein | - |
| AABA14_RS00360 (TKY123642_00630) | - | 58157..58573 (+) | 417 | WP_001165339.1 | phage holin family protein | - |
| AABA14_RS00365 (TKY123642_00640) | - | 58577..58909 (+) | 333 | WP_317680944.1 | phage holin | - |
| AABA14_RS00370 (TKY123642_00650) | - | 58913..59869 (+) | 957 | WP_000350503.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| AABA14_RS00375 (TKY123642_00660) | - | 60007..60186 (-) | 180 | WP_023937752.1 | hypothetical protein | - |
| AABA14_RS00380 (TKY123642_00670) | - | 60328..60477 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| AABA14_RS00385 (TKY123642_00680) | tadA | 60757..61224 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| AABA14_RS00395 (TKY123642_00690) | - | 61410..61853 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| AABA14_RS00400 (TKY123642_00700) | - | 61855..62370 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| AABA14_RS00405 (TKY123642_00710) | radA | 62384..63745 (+) | 1362 | WP_074017595.1 | DNA repair protein RadA | Machinery gene |
| AABA14_RS00410 (TKY123642_00720) | - | 63818..64315 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| AABA14_RS00415 (TKY123642_00730) | - | 64340..65123 (+) | 784 | Protein_75 | PrsW family glutamic-type intramembrane protease | - |
| AABA14_RS00420 (TKY123642_00740) | - | 65268..66236 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| AABA14_RS00425 (TKY123642_00750) | - | 66370..66651 (-) | 282 | Protein_77 | transposase family protein | - |
| AABA14_RS00430 | - | 66778..67685 (-) | 908 | Protein_78 | Rpn family recombination-promoting nuclease/putative transposase | - |
| AABA14_RS00435 (TKY123642_00780) | polA | 67941..70574 (+) | 2634 | WP_001852919.1 | DNA polymerase I | - |
| AABA14_RS00440 (TKY123642_00790) | - | 70659..71096 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| AABA14_RS00445 (TKY123642_00800) | - | 71332..72342 (-) | 1011 | WP_050150915.1 | YeiH family protein | - |
| AABA14_RS00450 (TKY123642_00820) | - | 72491..73660 (+) | 1170 | WP_000366342.1 | pyridoxal phosphate-dependent aminotransferase | - |
| AABA14_RS00455 (TKY123642_00830) | recO | 73657..74427 (+) | 771 | WP_000616164.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9686.14 Da Isoelectric Point: 6.7051
>NTDB_id=106251 AABA14_RS00115 WP_000939546.1 22173..22409(+) (comW) [Streptococcus pneumoniae strain Sep2]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=106251 AABA14_RS00115 WP_000939546.1 22173..22409(+) (comW) [Streptococcus pneumoniae strain Sep2]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae D39 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae R6 |
98.718 |
100 |
0.987 |
| comW | Streptococcus pneumoniae TIGR4 |
98.718 |
100 |
0.987 |
| comW | Streptococcus mitis SK321 |
76.923 |
100 |
0.769 |
| comW | Streptococcus mitis NCTC 12261 |
76.623 |
98.718 |
0.756 |