Detailed information    

insolico Bioinformatically predicted

Overview


Name   comW   Type   Regulator
Locus tag   AABA14_RS00115 Genome accession   NZ_AP028607
Coordinates   22173..22409 (+) Length   78 a.a.
NCBI ID   WP_000939546.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Sep2     
Function   stabilization and activation of ComX (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 12174..74427 22173..22409 within 0


Gene organization within MGE regions


Location: 12174..74427
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA14_RS00065 (TKY123642_00130) ftsH 12174..14132 (+) 1959 WP_000744557.1 ATP-dependent zinc metalloprotease FtsH -
  AABA14_RS00070 (TKY123642_00140) comX/comX2 14254..14733 (+) 480 WP_000588897.1 sigma-70 family RNA polymerase sigma factor Regulator
  AABA14_RS00105 - 20238..21076 (+) 839 Protein_14 IS630 family transposase -
  AABA14_RS00110 - 21136..21908 (-) 773 Protein_15 transposase -
  AABA14_RS00115 (TKY123642_00150) comW 22173..22409 (+) 237 WP_000939546.1 sigma(X)-activator ComW Regulator
  AABA14_RS00120 (TKY123642_00160) - 22640..23926 (+) 1287 WP_000205044.1 adenylosuccinate synthase -
  AABA14_RS00125 (TKY123642_00170) - 24168..25316 (-) 1149 WP_000876735.1 site-specific integrase -
  AABA14_RS00130 (TKY123642_00180) - 25488..26402 (-) 915 WP_317680939.1 HIRAN domain-containing protein -
  AABA14_RS00135 (TKY123642_00190) - 26415..27149 (-) 735 WP_001100508.1 S24 family peptidase -
  AABA14_RS00140 (TKY123642_00200) - 27315..27530 (+) 216 WP_000248658.1 helix-turn-helix domain-containing protein -
  AABA14_RS00145 (TKY123642_00210) - 27558..28268 (+) 711 WP_024475412.1 ORF6C domain-containing protein -
  AABA14_RS00150 (TKY123642_00220) - 28282..28539 (+) 258 WP_000370958.1 hypothetical protein -
  AABA14_RS00155 (TKY123642_00230) - 28625..28945 (+) 321 WP_000462824.1 hypothetical protein -
  AABA14_RS00160 (TKY123642_00240) - 28961..29257 (+) 297 WP_000391805.1 hypothetical protein -
  AABA14_RS00165 (TKY123642_00250) - 29250..30083 (+) 834 WP_024475411.1 phage replisome organizer N-terminal domain-containing protein -
  AABA14_RS00170 (TKY123642_00260) - 30071..30229 (+) 159 WP_168952850.1 hypothetical protein -
  AABA14_RS00175 (TKY123642_00270) - 30223..30993 (+) 771 WP_050203373.1 ATP-binding protein -
  AABA14_RS00180 (TKY123642_00280) - 31008..31202 (+) 195 WP_000470303.1 hypothetical protein -
  AABA14_RS00185 (TKY123642_00290) - 31202..31429 (+) 228 WP_000891969.1 hypothetical protein -
  AABA14_RS00190 (TKY123642_00300) - 31556..31720 (+) 165 WP_000233201.1 hypothetical protein -
  AABA14_RS00195 (TKY123642_00310) - 31710..31919 (+) 210 WP_001105098.1 hypothetical protein -
  AABA14_RS00200 (TKY123642_00320) - 31891..32208 (+) 318 WP_000969662.1 hypothetical protein -
  AABA14_RS00205 (TKY123642_00330) - 32210..32719 (+) 510 WP_001041150.1 DUF1642 domain-containing protein -
  AABA14_RS00210 (TKY123642_00340) - 32712..33311 (+) 600 WP_050201990.1 DUF1642 domain-containing protein -
  AABA14_RS00215 (TKY123642_00350) - 33311..33598 (+) 288 WP_000194862.1 hypothetical protein -
  AABA14_RS00220 (TKY123642_00360) - 33598..33786 (+) 189 WP_001277861.1 hypothetical protein -
  AABA14_RS00225 - 33865..33966 (+) 102 Protein_38 DUF3310 domain-containing protein -
  AABA14_RS00230 (TKY123642_00380) - 33959..34138 (+) 180 WP_000005958.1 hypothetical protein -
  AABA14_RS00235 (TKY123642_00390) - 34128..34358 (+) 231 WP_000653364.1 helix-turn-helix transcriptional regulator -
  AABA14_RS00240 (TKY123642_00400) - 34430..34858 (+) 429 WP_001165368.1 ArpU family phage packaging/lysis transcriptional regulator -
  AABA14_RS00245 (TKY123642_00410) - 35147..35713 (+) 567 WP_000754954.1 site-specific integrase -
  AABA14_RS00250 (TKY123642_00420) - 35947..36291 (+) 345 WP_001095652.1 HNH endonuclease signature motif containing protein -
  AABA14_RS00255 (TKY123642_00430) - 36430..37734 (+) 1305 WP_000172766.1 hypothetical protein -
  AABA14_RS00260 (TKY123642_00440) - 37688..39079 (+) 1392 WP_000228948.1 hypothetical protein -
  AABA14_RS00265 (TKY123642_00450) - 39069..39308 (+) 240 WP_000834150.1 hypothetical protein -
  AABA14_RS00270 (TKY123642_00460) - 39361..39591 (+) 231 WP_000528517.1 hypothetical protein -
  AABA14_RS00275 (TKY123642_00470) - 39642..41054 (+) 1413 WP_000101485.1 terminase -
  AABA14_RS00280 (TKY123642_00480) - 41136..41600 (+) 465 WP_001288685.1 DUF4355 domain-containing protein -
  AABA14_RS00285 (TKY123642_00490) - 41606..42505 (+) 900 WP_000774646.1 phage major capsid protein -
  AABA14_RS00290 (TKY123642_00500) - 42511..42723 (+) 213 WP_001240369.1 HeH/LEM domain-containing protein -
  AABA14_RS00295 (TKY123642_00510) - 42727..43167 (+) 441 WP_000526245.1 phage Gp19/Gp15/Gp42 family protein -
  AABA14_RS00300 (TKY123642_00520) - 43112..43450 (+) 339 WP_000221695.1 hypothetical protein -
  AABA14_RS00305 (TKY123642_00530) - 43452..43679 (+) 228 WP_001852278.1 hypothetical protein -
  AABA14_RS00310 (TKY123642_00540) - 43676..44011 (+) 336 WP_000571659.1 hypothetical protein -
  AABA14_RS00315 (TKY123642_00550) - 44078..44635 (+) 558 WP_033683240.1 hypothetical protein -
  AABA14_RS00320 (TKY123642_00560) - 44641..44916 (+) 276 WP_000387407.1 hypothetical protein -
  AABA14_RS00325 (TKY123642_00570) - 44928..45314 (+) 387 WP_000560881.1 DUF5361 domain-containing protein -
  AABA14_RS00330 (TKY123642_00580) - 45314..47779 (+) 2466 WP_000179968.1 hypothetical protein -
  AABA14_RS00335 (TKY123642_00590) - 47779..48477 (+) 699 WP_000499607.1 adenylosuccinate synthetase -
  AABA14_RS00340 (TKY123642_00600) - 48474..57497 (+) 9024 WP_317680943.1 phage tail spike protein -
  AABA14_RS00345 - 57494..57610 (+) 117 WP_001063632.1 hypothetical protein -
  AABA14_RS00350 (TKY123642_00610) - 57591..57794 (+) 204 WP_001091112.1 hypothetical protein -
  AABA14_RS00355 (TKY123642_00620) - 57797..58147 (+) 351 WP_000852244.1 hypothetical protein -
  AABA14_RS00360 (TKY123642_00630) - 58157..58573 (+) 417 WP_001165339.1 phage holin family protein -
  AABA14_RS00365 (TKY123642_00640) - 58577..58909 (+) 333 WP_317680944.1 phage holin -
  AABA14_RS00370 (TKY123642_00650) - 58913..59869 (+) 957 WP_000350503.1 N-acetylmuramoyl-L-alanine amidase family protein -
  AABA14_RS00375 (TKY123642_00660) - 60007..60186 (-) 180 WP_023937752.1 hypothetical protein -
  AABA14_RS00380 (TKY123642_00670) - 60328..60477 (-) 150 WP_001030863.1 hypothetical protein -
  AABA14_RS00385 (TKY123642_00680) tadA 60757..61224 (+) 468 WP_000291870.1 tRNA adenosine(34) deaminase TadA -
  AABA14_RS00395 (TKY123642_00690) - 61410..61853 (+) 444 WP_000701992.1 dUTP diphosphatase -
  AABA14_RS00400 (TKY123642_00700) - 61855..62370 (+) 516 WP_000691236.1 histidine phosphatase family protein -
  AABA14_RS00405 (TKY123642_00710) radA 62384..63745 (+) 1362 WP_074017595.1 DNA repair protein RadA Machinery gene
  AABA14_RS00410 (TKY123642_00720) - 63818..64315 (+) 498 WP_001809263.1 carbonic anhydrase -
  AABA14_RS00415 (TKY123642_00730) - 64340..65123 (+) 784 Protein_75 PrsW family glutamic-type intramembrane protease -
  AABA14_RS00420 (TKY123642_00740) - 65268..66236 (+) 969 WP_000010163.1 ribose-phosphate diphosphokinase -
  AABA14_RS00425 (TKY123642_00750) - 66370..66651 (-) 282 Protein_77 transposase family protein -
  AABA14_RS00430 - 66778..67685 (-) 908 Protein_78 Rpn family recombination-promoting nuclease/putative transposase -
  AABA14_RS00435 (TKY123642_00780) polA 67941..70574 (+) 2634 WP_001852919.1 DNA polymerase I -
  AABA14_RS00440 (TKY123642_00790) - 70659..71096 (+) 438 WP_000076479.1 CoA-binding protein -
  AABA14_RS00445 (TKY123642_00800) - 71332..72342 (-) 1011 WP_050150915.1 YeiH family protein -
  AABA14_RS00450 (TKY123642_00820) - 72491..73660 (+) 1170 WP_000366342.1 pyridoxal phosphate-dependent aminotransferase -
  AABA14_RS00455 (TKY123642_00830) recO 73657..74427 (+) 771 WP_000616164.1 DNA repair protein RecO -

Sequence


Protein


Download         Length: 78 a.a.        Molecular weight: 9686.14 Da        Isoelectric Point: 6.7051

>NTDB_id=106251 AABA14_RS00115 WP_000939546.1 22173..22409(+) (comW) [Streptococcus pneumoniae strain Sep2]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRRDFIVYHYRVAYRLYLEKLVMNRGFISC

Nucleotide


Download         Length: 237 bp        

>NTDB_id=106251 AABA14_RS00115 WP_000939546.1 22173..22409(+) (comW) [Streptococcus pneumoniae strain Sep2]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAGGGATTTTA
TCGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comW Streptococcus pneumoniae Rx1

98.718

100

0.987

  comW Streptococcus pneumoniae D39

98.718

100

0.987

  comW Streptococcus pneumoniae R6

98.718

100

0.987

  comW Streptococcus pneumoniae TIGR4

98.718

100

0.987

  comW Streptococcus mitis SK321

76.923

100

0.769

  comW Streptococcus mitis NCTC 12261

76.623

98.718

0.756


Multiple sequence alignment