Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   ACF3OJ_RS03115 Genome accession   NZ_CP171111
Coordinates   607742..608173 (-) Length   143 a.a.
NCBI ID   WP_392406380.1    Uniprot ID   -
Organism   Cardiobacterium hominis strain WGS1530     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 604589..648928 607742..608173 within 0


Gene organization within MGE regions


Location: 604589..648928
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF3OJ_RS03085 (ACF3OJ_03085) - 604589..605017 (-) 429 WP_392406373.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  ACF3OJ_RS03090 (ACF3OJ_03090) - 605185..605415 (-) 231 WP_392406374.1 hypothetical protein -
  ACF3OJ_RS03095 (ACF3OJ_03095) - 605466..605759 (-) 294 WP_079540343.1 hypothetical protein -
  ACF3OJ_RS03100 (ACF3OJ_03100) - 605756..606523 (-) 768 WP_392406375.1 hypothetical protein -
  ACF3OJ_RS03105 (ACF3OJ_03105) - 606573..607382 (-) 810 WP_392406376.1 DUF2303 family protein -
  ACF3OJ_RS03110 (ACF3OJ_03110) - 607394..607720 (-) 327 WP_392406378.1 hypothetical protein -
  ACF3OJ_RS03115 (ACF3OJ_03115) ssb 607742..608173 (-) 432 WP_392406380.1 single-stranded DNA-binding protein Machinery gene
  ACF3OJ_RS03120 (ACF3OJ_03120) - 608176..608790 (-) 615 WP_392406381.1 lambda exonuclease family protein -
  ACF3OJ_RS03125 (ACF3OJ_03125) - 608794..609588 (-) 795 WP_392406383.1 recombinase RecT -
  ACF3OJ_RS03130 (ACF3OJ_03130) - 609591..610562 (-) 972 WP_392406385.1 hypothetical protein -
  ACF3OJ_RS03135 (ACF3OJ_03135) - 610559..610864 (-) 306 WP_079540355.1 hypothetical protein -
  ACF3OJ_RS03140 (ACF3OJ_03140) - 610861..611115 (-) 255 WP_079540357.1 hypothetical protein -
  ACF3OJ_RS03145 (ACF3OJ_03145) - 611112..611393 (-) 282 WP_392406387.1 hypothetical protein -
  ACF3OJ_RS03150 (ACF3OJ_03150) - 611390..611740 (-) 351 WP_392406389.1 hypothetical protein -
  ACF3OJ_RS03155 (ACF3OJ_03155) - 611737..611925 (-) 189 WP_392406391.1 hypothetical protein -
  ACF3OJ_RS03160 (ACF3OJ_03160) - 611922..612257 (-) 336 WP_392406392.1 hypothetical protein -
  ACF3OJ_RS03165 (ACF3OJ_03165) - 612597..613889 (-) 1293 WP_392406393.1 DUF4236 domain-containing protein -
  ACF3OJ_RS03170 (ACF3OJ_03170) - 613903..614619 (-) 717 WP_392406395.1 S24 family peptidase -
  ACF3OJ_RS03175 (ACF3OJ_03175) - 614738..614971 (+) 234 WP_392406396.1 Cro/CI family transcriptional regulator -
  ACF3OJ_RS03180 (ACF3OJ_03180) - 615045..615299 (+) 255 WP_392406398.1 hypothetical protein -
  ACF3OJ_RS03185 (ACF3OJ_03185) - 615296..615577 (+) 282 WP_392406399.1 hypothetical protein -
  ACF3OJ_RS03190 (ACF3OJ_03190) - 615574..616116 (+) 543 WP_392406401.1 hypothetical protein -
  ACF3OJ_RS03195 (ACF3OJ_03195) - 616113..616421 (+) 309 WP_392406402.1 hypothetical protein -
  ACF3OJ_RS03200 (ACF3OJ_03200) - 616435..617484 (+) 1050 WP_392406403.1 hypothetical protein -
  ACF3OJ_RS03205 (ACF3OJ_03205) - 617471..618166 (+) 696 WP_392406405.1 DUF6475 domain-containing protein -
  ACF3OJ_RS03210 (ACF3OJ_03210) - 618163..618654 (+) 492 WP_392406406.1 hypothetical protein -
  ACF3OJ_RS03215 (ACF3OJ_03215) - 618644..618820 (+) 177 WP_392406408.1 hypothetical protein -
  ACF3OJ_RS03220 (ACF3OJ_03220) - 618813..619052 (+) 240 WP_392406410.1 hypothetical protein -
  ACF3OJ_RS03225 (ACF3OJ_03225) - 619049..619519 (+) 471 WP_392406411.1 recombination protein NinB -
  ACF3OJ_RS03230 (ACF3OJ_03230) - 619516..619752 (+) 237 WP_079540395.1 hypothetical protein -
  ACF3OJ_RS03235 (ACF3OJ_03235) - 619752..620090 (+) 339 WP_281838796.1 nuclease domain-containing protein -
  ACF3OJ_RS03240 (ACF3OJ_03240) - 620087..621067 (+) 981 WP_392406413.1 hypothetical protein -
  ACF3OJ_RS03245 (ACF3OJ_03245) - 621177..621551 (+) 375 WP_392406415.1 antiterminator Q family protein -
  ACF3OJ_RS03250 (ACF3OJ_03250) - 621615..621974 (+) 360 WP_392406417.1 helix-turn-helix transcriptional regulator -
  ACF3OJ_RS03255 (ACF3OJ_03255) - 621971..622501 (+) 531 WP_392406419.1 ImmA/IrrE family metallo-endopeptidase -
  ACF3OJ_RS03260 (ACF3OJ_03260) - 623130..623987 (+) 858 WP_392406421.1 glycoside hydrolase family 108 protein -
  ACF3OJ_RS03265 (ACF3OJ_03265) - 623971..624243 (+) 273 WP_392406423.1 hypothetical protein -
  ACF3OJ_RS03270 (ACF3OJ_03270) - 624227..624634 (+) 408 WP_392406424.1 hypothetical protein -
  ACF3OJ_RS03275 (ACF3OJ_03275) - 624624..624866 (+) 243 WP_392406425.1 hypothetical protein -
  ACF3OJ_RS03280 (ACF3OJ_03280) - 624850..625203 (+) 354 WP_392406426.1 hypothetical protein -
  ACF3OJ_RS03285 (ACF3OJ_03285) - 625203..625694 (+) 492 WP_143312253.1 hypothetical protein -
  ACF3OJ_RS03290 (ACF3OJ_03290) - 625684..626946 (+) 1263 WP_392406429.1 PBSX family phage terminase large subunit -
  ACF3OJ_RS03295 (ACF3OJ_03295) - 626955..628388 (+) 1434 WP_392406430.1 DUF935 family protein -
  ACF3OJ_RS03300 (ACF3OJ_03300) - 628388..629929 (+) 1542 WP_392406432.1 phage minor head protein -
  ACF3OJ_RS03305 (ACF3OJ_03305) - 629926..630315 (+) 390 WP_392406434.1 hypothetical protein -
  ACF3OJ_RS03310 (ACF3OJ_03310) - 630431..630958 (+) 528 WP_392406435.1 BRO family protein -
  ACF3OJ_RS03315 (ACF3OJ_03315) - 630995..631396 (+) 402 WP_392406436.1 hypothetical protein -
  ACF3OJ_RS03320 (ACF3OJ_03320) - 631393..632196 (+) 804 WP_392406438.1 hypothetical protein -
  ACF3OJ_RS03325 (ACF3OJ_03325) - 632253..633242 (+) 990 WP_079540425.1 major capsid protein -
  ACF3OJ_RS03330 (ACF3OJ_03330) - 633242..633712 (+) 471 WP_392406439.1 phage protein Gp36 family protein -
  ACF3OJ_RS03335 (ACF3OJ_03335) - 633712..634122 (+) 411 WP_392406441.1 phage virion morphogenesis protein -
  ACF3OJ_RS03340 (ACF3OJ_03340) - 634103..634555 (+) 453 WP_392406443.1 hypothetical protein -
  ACF3OJ_RS03345 (ACF3OJ_03345) - 634559..635311 (+) 753 WP_392406444.1 hypothetical protein -
  ACF3OJ_RS03350 (ACF3OJ_03350) - 635321..635482 (+) 162 WP_392406446.1 hypothetical protein -
  ACF3OJ_RS03355 (ACF3OJ_03355) - 635555..636064 (+) 510 WP_392406448.1 thermonuclease family protein -
  ACF3OJ_RS03360 (ACF3OJ_03360) - 636048..636323 (+) 276 WP_392406449.1 hypothetical protein -
  ACF3OJ_RS03365 (ACF3OJ_03365) - 636426..640451 (+) 4026 WP_392406451.1 phage tail tape measure protein -
  ACF3OJ_RS03370 (ACF3OJ_03370) - 640448..640849 (+) 402 WP_392406205.1 hypothetical protein -
  ACF3OJ_RS03375 (ACF3OJ_03375) - 640869..644492 (+) 3624 WP_392406452.1 hypothetical protein -
  ACF3OJ_RS03380 (ACF3OJ_03380) - 644619..645470 (+) 852 WP_392406454.1 hypothetical protein -
  ACF3OJ_RS03385 (ACF3OJ_03385) - 645470..645790 (+) 321 WP_392406456.1 hypothetical protein -
  ACF3OJ_RS03390 (ACF3OJ_03390) - 645833..647656 (+) 1824 WP_392406458.1 hypothetical protein -
  ACF3OJ_RS03395 (ACF3OJ_03395) - 647658..647888 (+) 231 WP_392406460.1 hypothetical protein -
  ACF3OJ_RS03400 (ACF3OJ_03400) - 647954..648928 (-) 975 WP_392406462.1 site-specific integrase -

Sequence


Protein


Download         Length: 143 a.a.        Molecular weight: 16110.13 Da        Isoelectric Point: 7.1664

>NTDB_id=1060135 ACF3OJ_RS03115 WP_392406380.1 607742..608173(-) (ssb) [Cardiobacterium hominis strain WGS1530]
MAGVNKVILIGRLGNDPEMRYMPSGEAVANLSIATSESWTDKTTGAKREKTEWHRVVAFRKLAEIIGQYCKKGDQIYIEG
KLQTRKWTDKNGQDHYTTEIIADQMQMLGNKDNGNRGQSEKPGRFPDPPPNPAPQTFDDDIPF

Nucleotide


Download         Length: 432 bp        

>NTDB_id=1060135 ACF3OJ_RS03115 WP_392406380.1 607742..608173(-) (ssb) [Cardiobacterium hominis strain WGS1530]
ATGGCAGGCGTCAACAAAGTCATACTCATCGGCCGCCTCGGCAACGACCCGGAAATGCGTTACATGCCCAGCGGCGAAGC
CGTAGCGAACCTATCCATTGCCACCTCGGAAAGCTGGACGGACAAAACCACCGGCGCAAAACGCGAAAAAACCGAATGGC
ACCGAGTCGTGGCCTTCCGCAAGCTGGCGGAAATCATCGGCCAGTACTGCAAGAAAGGCGACCAAATCTACATCGAGGGC
AAGCTGCAAACCCGCAAATGGACCGACAAGAACGGTCAAGACCACTACACCACCGAAATCATTGCTGACCAGATGCAGAT
GCTTGGCAATAAAGACAACGGCAACCGGGGACAAAGCGAGAAGCCGGGACGGTTTCCCGATCCACCGCCGAACCCTGCCC
CGCAAACCTTTGACGACGACATACCCTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

49.444

100

0.622

  ssb Vibrio cholerae strain A1552

50.289

100

0.608

  ssb Neisseria gonorrhoeae MS11

44

100

0.538

  ssb Neisseria meningitidis MC58

42.775

100

0.517


Multiple sequence alignment