Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | AABA08_RS10465 | Genome accession | NZ_AP028602 |
| Coordinates | 2047098..2047223 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae strain PF2 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2042098..2052223
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AABA08_RS10435 | - | 2042479..2044090 (-) | 1612 | Protein_2018 | YhgE/Pip family protein | - |
| AABA08_RS10440 (TKY092604_20210) | - | 2044218..2044760 (+) | 543 | WP_001158263.1 | TetR/AcrR family transcriptional regulator | - |
| AABA08_RS10455 (TKY092604_20220) | comE | 2045003..2045755 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| AABA08_RS10460 (TKY092604_20230) | comD/comD2 | 2045752..2047077 (-) | 1326 | WP_001842237.1 | competence system sensor histidine kinase ComD | Regulator |
| AABA08_RS10465 | comC/comC2 | 2047098..2047223 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| AABA08_RS10475 (TKY092604_20240) | rlmH | 2047505..2047984 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| AABA08_RS10480 (TKY092604_20250) | htrA | 2048167..2049348 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| AABA08_RS10485 (TKY092604_20260) | spo0J | 2049406..2050164 (+) | 759 | WP_000410380.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=105932 AABA08_RS10465 WP_000799686.1 2047098..2047223(-) (comC/comC2) [Streptococcus pneumoniae strain PF2]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=105932 AABA08_RS10465 WP_000799686.1 2047098..2047223(-) (comC/comC2) [Streptococcus pneumoniae strain PF2]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |