Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   ACFXAA_RS19190 Genome accession   NZ_CP170717
Coordinates   3906107..3906544 (+) Length   145 a.a.
NCBI ID   WP_395135502.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain JP5014     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3901107..3911544
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACFXAA_RS19165 (ACFXAA_19165) - 3901120..3902421 (-) 1302 WP_012117986.1 hemolysin family protein -
  ACFXAA_RS19170 (ACFXAA_19170) - 3902567..3903517 (+) 951 WP_015417820.1 magnesium transporter CorA family protein -
  ACFXAA_RS19175 (ACFXAA_19175) comGA 3903710..3904780 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  ACFXAA_RS19180 (ACFXAA_19180) comGB 3904767..3905804 (+) 1038 WP_395135501.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACFXAA_RS19185 (ACFXAA_19185) comGC 3905851..3906117 (+) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  ACFXAA_RS19190 (ACFXAA_19190) comGD 3906107..3906544 (+) 438 WP_395135502.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACFXAA_RS19195 (ACFXAA_19195) comGE 3906528..3906842 (+) 315 WP_094032244.1 competence type IV pilus minor pilin ComGE -
  ACFXAA_RS19200 (ACFXAA_19200) comGF 3906751..3907251 (+) 501 WP_258566475.1 competence type IV pilus minor pilin ComGF -
  ACFXAA_RS19205 (ACFXAA_19205) comGG 3907252..3907629 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACFXAA_RS19210 (ACFXAA_19210) - 3907686..3907865 (+) 180 WP_003153093.1 YqzE family protein -
  ACFXAA_RS19215 (ACFXAA_19215) - 3907905..3908234 (-) 330 WP_060674607.1 DUF3889 domain-containing protein -
  ACFXAA_RS19220 (ACFXAA_19220) tapA 3908493..3909164 (+) 672 WP_060674605.1 amyloid fiber anchoring/assembly protein TapA -
  ACFXAA_RS19225 (ACFXAA_19225) sipW 3909136..3909720 (+) 585 WP_061860711.1 signal peptidase I SipW -
  ACFXAA_RS19230 (ACFXAA_19230) tasA 3909785..3910570 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACFXAA_RS19235 (ACFXAA_19235) sinR 3910618..3910953 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACFXAA_RS19240 (ACFXAA_19240) sinI 3910987..3911160 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.77 Da        Isoelectric Point: 10.2172

>NTDB_id=1058696 ACFXAA_RS19190 WP_395135502.1 3906107..3906544(+) (comGD) [Bacillus amyloliquefaciens strain JP5014]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHRYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1058696 ACFXAA_RS19190 WP_395135502.1 3906107..3906544(+) (comGD) [Bacillus amyloliquefaciens strain JP5014]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAGATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559


Multiple sequence alignment