Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACFXAA_RS19240 | Genome accession | NZ_CP170717 |
| Coordinates | 3910987..3911160 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain JP5014 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3905987..3916160
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACFXAA_RS19190 (ACFXAA_19190) | comGD | 3906107..3906544 (+) | 438 | WP_395135502.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| ACFXAA_RS19195 (ACFXAA_19195) | comGE | 3906528..3906842 (+) | 315 | WP_094032244.1 | competence type IV pilus minor pilin ComGE | - |
| ACFXAA_RS19200 (ACFXAA_19200) | comGF | 3906751..3907251 (+) | 501 | WP_258566475.1 | competence type IV pilus minor pilin ComGF | - |
| ACFXAA_RS19205 (ACFXAA_19205) | comGG | 3907252..3907629 (+) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACFXAA_RS19210 (ACFXAA_19210) | - | 3907686..3907865 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACFXAA_RS19215 (ACFXAA_19215) | - | 3907905..3908234 (-) | 330 | WP_060674607.1 | DUF3889 domain-containing protein | - |
| ACFXAA_RS19220 (ACFXAA_19220) | tapA | 3908493..3909164 (+) | 672 | WP_060674605.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACFXAA_RS19225 (ACFXAA_19225) | sipW | 3909136..3909720 (+) | 585 | WP_061860711.1 | signal peptidase I SipW | - |
| ACFXAA_RS19230 (ACFXAA_19230) | tasA | 3909785..3910570 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACFXAA_RS19235 (ACFXAA_19235) | sinR | 3910618..3910953 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACFXAA_RS19240 (ACFXAA_19240) | sinI | 3910987..3911160 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACFXAA_RS19245 (ACFXAA_19245) | - | 3911337..3912131 (-) | 795 | WP_061860710.1 | YqhG family protein | - |
| ACFXAA_RS19250 (ACFXAA_19250) | - | 3912153..3913823 (-) | 1671 | WP_031378948.1 | DEAD/DEAH box helicase | - |
| ACFXAA_RS19255 (ACFXAA_19255) | gcvT | 3914247..3915347 (+) | 1101 | WP_163069075.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1058699 ACFXAA_RS19240 WP_003153105.1 3910987..3911160(-) (sinI) [Bacillus amyloliquefaciens strain JP5014]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1058699 ACFXAA_RS19240 WP_003153105.1 3910987..3911160(-) (sinI) [Bacillus amyloliquefaciens strain JP5014]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |