Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABUS40_RS15985 | Genome accession | NZ_CP169788 |
| Coordinates | 3368746..3369099 (+) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain Hv766 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3340132..3371465 | 3368746..3369099 | within | 0 |
Gene organization within MGE regions
Location: 3340132..3371465
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABUS40_RS15795 | - | 3340132..3341130 (-) | 999 | WP_001284079.1 | phage portal protein | - |
| ABUS40_RS15800 | - | 3341130..3342938 (-) | 1809 | WP_000289875.1 | terminase large subunit domain-containing protein | - |
| ABUS40_RS15805 | - | 3343076..3343903 (+) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| ABUS40_RS15810 | - | 3343956..3344945 (+) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| ABUS40_RS15815 | gpM | 3344956..3345702 (+) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| ABUS40_RS15820 | - | 3345806..3346258 (+) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| ABUS40_RS15825 | - | 3346259..3346468 (+) | 210 | WP_000659474.1 | tail protein X | - |
| ABUS40_RS15830 | - | 3346477..3346827 (+) | 351 | WP_001114936.1 | putative holin | - |
| ABUS40_RS15835 | - | 3346824..3347093 (+) | 270 | WP_000571491.1 | phage holin family protein | - |
| ABUS40_RS15840 | - | 3347090..3347920 (+) | 831 | WP_000600982.1 | N-acetylmuramidase family protein | - |
| ABUS40_RS15845 | - | 3347917..3348444 (+) | 528 | WP_000742888.1 | phage tail protein | - |
| ABUS40_RS15850 | - | 3348441..3348890 (+) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| ABUS40_RS15855 | - | 3348963..3349595 (+) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| ABUS40_RS15860 | - | 3349592..3349939 (+) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| ABUS40_RS15865 | - | 3349936..3350838 (+) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| ABUS40_RS15870 | - | 3350838..3351443 (+) | 606 | WP_001050805.1 | phage tail protein I | - |
| ABUS40_RS15875 | - | 3351455..3353407 (+) | 1953 | WP_000729646.1 | phage tail protein | - |
| ABUS40_RS15880 | - | 3353557..3354732 (+) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| ABUS40_RS15885 | - | 3354745..3355263 (+) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| ABUS40_RS15890 | - | 3355330..3355671 (+) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| ABUS40_RS15895 | - | 3355707..3355811 (+) | 105 | WP_225463614.1 | GpE family phage tail protein | - |
| ABUS40_RS15900 | - | 3355825..3358275 (+) | 2451 | WP_375591382.1 | phage tail tape measure protein | - |
| ABUS40_RS15905 | - | 3358281..3358721 (+) | 441 | WP_000979757.1 | phage tail protein | - |
| ABUS40_RS15910 | - | 3358722..3360035 (+) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| ABUS40_RS15915 | - | 3360165..3360404 (+) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| ABUS40_RS15920 | - | 3360401..3360601 (+) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| ABUS40_RS15925 | - | 3360917..3361198 (-) | 282 | WP_000713873.1 | hypothetical protein | - |
| ABUS40_RS15930 | - | 3361198..3362076 (-) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| ABUS40_RS15935 | - | 3362386..3362580 (+) | 195 | WP_000696053.1 | hypothetical protein | - |
| ABUS40_RS15940 | - | 3362688..3363503 (+) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| ABUS40_RS15945 | - | 3363628..3363843 (+) | 216 | WP_000556352.1 | hypothetical protein | - |
| ABUS40_RS15950 | - | 3363888..3364229 (-) | 342 | WP_000786718.1 | helix-turn-helix transcriptional regulator | - |
| ABUS40_RS15955 | - | 3364322..3364510 (+) | 189 | WP_375591383.1 | hypothetical protein | - |
| ABUS40_RS15960 | - | 3364604..3367342 (+) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| ABUS40_RS15965 | - | 3367339..3367671 (+) | 333 | WP_000632296.1 | hypothetical protein | - |
| ABUS40_RS15970 | - | 3367737..3368288 (+) | 552 | WP_001178668.1 | hypothetical protein | - |
| ABUS40_RS15975 | - | 3368278..3368448 (+) | 171 | WP_375591384.1 | hypothetical protein | - |
| ABUS40_RS15980 | - | 3368441..3368758 (+) | 318 | WP_000049658.1 | hypothetical protein | - |
| ABUS40_RS15985 | ssb | 3368746..3369099 (+) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| ABUS40_RS15990 | - | 3369109..3369846 (+) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| ABUS40_RS15995 | - | 3369856..3370077 (+) | 222 | WP_000424605.1 | hypothetical protein | - |
| ABUS40_RS16000 | - | 3370074..3370370 (+) | 297 | WP_000218943.1 | hypothetical protein | - |
| ABUS40_RS16005 | - | 3370398..3371465 (-) | 1068 | WP_000107854.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=1053038 ABUS40_RS15985 WP_002014678.1 3368746..3369099(+) (ssb) [Acinetobacter baumannii strain Hv766]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=1053038 ABUS40_RS15985 WP_002014678.1 3368746..3369099(+) (ssb) [Acinetobacter baumannii strain Hv766]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |