Detailed information NTG1051874

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACE1EH_RS11630
• Genome accession: NZ_CP169535
• Coordinates: 2435472..2435909 (-)
• Length: 145 a.a.
• NCBI ID: WP_007612572.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain HJ-16
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2430472..2440909

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACE1EH_RS11580 (ACE1EH_11580)	sinI	2430855..2431028 (+)	174	WP_007612543.1	anti-repressor SinI	Regulator
ACE1EH_RS11585 (ACE1EH_11585)	sinR	2431062..2431397 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACE1EH_RS11590 (ACE1EH_11590)	tasA	2431445..2432230 (-)	786	WP_044802563.1	biofilm matrix protein TasA	-
ACE1EH_RS11595 (ACE1EH_11595)	sipW	2432295..2432879 (-)	585	WP_375004234.1	signal peptidase I SipW	-
ACE1EH_RS11600 (ACE1EH_11600)	tapA	2432851..2433522 (-)	672	WP_375004235.1	amyloid fiber anchoring/assembly protein TapA	-
ACE1EH_RS11605 (ACE1EH_11605)	-	2433781..2434110 (+)	330	WP_038459175.1	DUF3889 domain-containing protein	-
ACE1EH_RS11610 (ACE1EH_11610)	-	2434151..2434330 (-)	180	WP_003153093.1	YqzE family protein	-
ACE1EH_RS11615 (ACE1EH_11615)	comGG	2434387..2434764 (-)	378	WP_375004236.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACE1EH_RS11620 (ACE1EH_11620)	comGF	2434765..2435265 (-)	501	WP_375004237.1	competence type IV pilus minor pilin ComGF	-
ACE1EH_RS11625 (ACE1EH_11625)	comGE	2435174..2435488 (-)	315	WP_326155219.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACE1EH_RS11630 (ACE1EH_11630)	comGD	2435472..2435909 (-)	438	WP_007612572.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACE1EH_RS11635 (ACE1EH_11635)	comGC	2435899..2436207 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACE1EH_RS11640 (ACE1EH_11640)	comGB	2436212..2437249 (-)	1038	WP_375004238.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACE1EH_RS11645 (ACE1EH_11645)	comGA	2437236..2438306 (-)	1071	WP_007612574.1	competence type IV pilus ATPase ComGA	Machinery gene
ACE1EH_RS11650 (ACE1EH_11650)	-	2438503..2439453 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
ACE1EH_RS11655 (ACE1EH_11655)	-	2439599..2440900 (+)	1302	WP_375004239.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16254.76 Da
• Isoelectric Point: 10.1850

>NTDB_id=1051874 ACE1EH_RS11630 WP_007612572.1 2435472..2435909(-) (comGD) [Bacillus velezensis strain HJ-16]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1051874 ACE1EH_RS11630 WP_007612572.1 2435472..2435909(-) (comGD) [Bacillus velezensis strain HJ-16]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACAGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCATATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	55.479	100	0.559