Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACE1EH_RS11615 Genome accession   NZ_CP169535
Coordinates   2434387..2434764 (-) Length   125 a.a.
NCBI ID   WP_375004236.1    Uniprot ID   -
Organism   Bacillus velezensis strain HJ-16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2429387..2439764
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE1EH_RS11575 (ACE1EH_11575) - 2429884..2430678 (+) 795 WP_007612541.1 YqhG family protein -
  ACE1EH_RS11580 (ACE1EH_11580) sinI 2430855..2431028 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  ACE1EH_RS11585 (ACE1EH_11585) sinR 2431062..2431397 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACE1EH_RS11590 (ACE1EH_11590) tasA 2431445..2432230 (-) 786 WP_044802563.1 biofilm matrix protein TasA -
  ACE1EH_RS11595 (ACE1EH_11595) sipW 2432295..2432879 (-) 585 WP_375004234.1 signal peptidase I SipW -
  ACE1EH_RS11600 (ACE1EH_11600) tapA 2432851..2433522 (-) 672 WP_375004235.1 amyloid fiber anchoring/assembly protein TapA -
  ACE1EH_RS11605 (ACE1EH_11605) - 2433781..2434110 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  ACE1EH_RS11610 (ACE1EH_11610) - 2434151..2434330 (-) 180 WP_003153093.1 YqzE family protein -
  ACE1EH_RS11615 (ACE1EH_11615) comGG 2434387..2434764 (-) 378 WP_375004236.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACE1EH_RS11620 (ACE1EH_11620) comGF 2434765..2435265 (-) 501 WP_375004237.1 competence type IV pilus minor pilin ComGF -
  ACE1EH_RS11625 (ACE1EH_11625) comGE 2435174..2435488 (-) 315 WP_326155219.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACE1EH_RS11630 (ACE1EH_11630) comGD 2435472..2435909 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACE1EH_RS11635 (ACE1EH_11635) comGC 2435899..2436207 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACE1EH_RS11640 (ACE1EH_11640) comGB 2436212..2437249 (-) 1038 WP_375004238.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACE1EH_RS11645 (ACE1EH_11645) comGA 2437236..2438306 (-) 1071 WP_007612574.1 competence type IV pilus ATPase ComGA Machinery gene
  ACE1EH_RS11650 (ACE1EH_11650) - 2438503..2439453 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14111.03 Da        Isoelectric Point: 10.1253

>NTDB_id=1051872 ACE1EH_RS11615 WP_375004236.1 2434387..2434764(-) (comGG) [Bacillus velezensis strain HJ-16]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWSGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1051872 ACE1EH_RS11615 WP_375004236.1 2434387..2434764(-) (comGG) [Bacillus velezensis strain HJ-16]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTTATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGAGCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGCGAAACGGTTCAGGTTACAATCCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment