Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACE1EH_RS11580 | Genome accession | NZ_CP169535 |
| Coordinates | 2430855..2431028 (+) | Length | 57 a.a. |
| NCBI ID | WP_007612543.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain HJ-16 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2425855..2436028
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACE1EH_RS11565 (ACE1EH_11565) | gcvT | 2426668..2427768 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACE1EH_RS11570 (ACE1EH_11570) | - | 2428192..2429862 (+) | 1671 | WP_224182193.1 | DEAD/DEAH box helicase | - |
| ACE1EH_RS11575 (ACE1EH_11575) | - | 2429884..2430678 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| ACE1EH_RS11580 (ACE1EH_11580) | sinI | 2430855..2431028 (+) | 174 | WP_007612543.1 | anti-repressor SinI | Regulator |
| ACE1EH_RS11585 (ACE1EH_11585) | sinR | 2431062..2431397 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACE1EH_RS11590 (ACE1EH_11590) | tasA | 2431445..2432230 (-) | 786 | WP_044802563.1 | biofilm matrix protein TasA | - |
| ACE1EH_RS11595 (ACE1EH_11595) | sipW | 2432295..2432879 (-) | 585 | WP_375004234.1 | signal peptidase I SipW | - |
| ACE1EH_RS11600 (ACE1EH_11600) | tapA | 2432851..2433522 (-) | 672 | WP_375004235.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACE1EH_RS11605 (ACE1EH_11605) | - | 2433781..2434110 (+) | 330 | WP_038459175.1 | DUF3889 domain-containing protein | - |
| ACE1EH_RS11610 (ACE1EH_11610) | - | 2434151..2434330 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACE1EH_RS11615 (ACE1EH_11615) | comGG | 2434387..2434764 (-) | 378 | WP_375004236.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACE1EH_RS11620 (ACE1EH_11620) | comGF | 2434765..2435265 (-) | 501 | WP_375004237.1 | competence type IV pilus minor pilin ComGF | - |
| ACE1EH_RS11625 (ACE1EH_11625) | comGE | 2435174..2435488 (-) | 315 | WP_326155219.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ACE1EH_RS11630 (ACE1EH_11630) | comGD | 2435472..2435909 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6672.68 Da Isoelectric Point: 9.8168
>NTDB_id=1051870 ACE1EH_RS11580 WP_007612543.1 2430855..2431028(+) (sinI) [Bacillus velezensis strain HJ-16]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1051870 ACE1EH_RS11580 WP_007612543.1 2430855..2431028(+) (sinI) [Bacillus velezensis strain HJ-16]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |