Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ACE1EH_RS11580 Genome accession   NZ_CP169535
Coordinates   2430855..2431028 (+) Length   57 a.a.
NCBI ID   WP_007612543.1    Uniprot ID   -
Organism   Bacillus velezensis strain HJ-16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2425855..2436028
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACE1EH_RS11565 (ACE1EH_11565) gcvT 2426668..2427768 (-) 1101 WP_012117974.1 glycine cleavage system aminomethyltransferase GcvT -
  ACE1EH_RS11570 (ACE1EH_11570) - 2428192..2429862 (+) 1671 WP_224182193.1 DEAD/DEAH box helicase -
  ACE1EH_RS11575 (ACE1EH_11575) - 2429884..2430678 (+) 795 WP_007612541.1 YqhG family protein -
  ACE1EH_RS11580 (ACE1EH_11580) sinI 2430855..2431028 (+) 174 WP_007612543.1 anti-repressor SinI Regulator
  ACE1EH_RS11585 (ACE1EH_11585) sinR 2431062..2431397 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACE1EH_RS11590 (ACE1EH_11590) tasA 2431445..2432230 (-) 786 WP_044802563.1 biofilm matrix protein TasA -
  ACE1EH_RS11595 (ACE1EH_11595) sipW 2432295..2432879 (-) 585 WP_375004234.1 signal peptidase I SipW -
  ACE1EH_RS11600 (ACE1EH_11600) tapA 2432851..2433522 (-) 672 WP_375004235.1 amyloid fiber anchoring/assembly protein TapA -
  ACE1EH_RS11605 (ACE1EH_11605) - 2433781..2434110 (+) 330 WP_038459175.1 DUF3889 domain-containing protein -
  ACE1EH_RS11610 (ACE1EH_11610) - 2434151..2434330 (-) 180 WP_003153093.1 YqzE family protein -
  ACE1EH_RS11615 (ACE1EH_11615) comGG 2434387..2434764 (-) 378 WP_375004236.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACE1EH_RS11620 (ACE1EH_11620) comGF 2434765..2435265 (-) 501 WP_375004237.1 competence type IV pilus minor pilin ComGF -
  ACE1EH_RS11625 (ACE1EH_11625) comGE 2435174..2435488 (-) 315 WP_326155219.1 competence type IV pilus minor pilin ComGE Machinery gene
  ACE1EH_RS11630 (ACE1EH_11630) comGD 2435472..2435909 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6672.68 Da        Isoelectric Point: 9.8168

>NTDB_id=1051870 ACE1EH_RS11580 WP_007612543.1 2430855..2431028(+) (sinI) [Bacillus velezensis strain HJ-16]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1051870 ACE1EH_RS11580 WP_007612543.1 2430855..2431028(+) (sinI) [Bacillus velezensis strain HJ-16]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719

Multiple sequence alignment