Detailed information NTG1051732

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: ACEYXE_RS11735
• Genome accession: NZ_CP169521
• Coordinates: 2402429..2402866 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain SZ-T8
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2397429..2407866

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACEYXE_RS11685 (ACEYXE_11685)	sinI	2397813..2397986 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
ACEYXE_RS11690 (ACEYXE_11690)	sinR	2398020..2398355 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
ACEYXE_RS11695 (ACEYXE_11695)	tasA	2398403..2399188 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
ACEYXE_RS11700 (ACEYXE_11700)	sipW	2399253..2399837 (-)	585	WP_012117977.1	signal peptidase I SipW	-
ACEYXE_RS11705 (ACEYXE_11705)	tapA	2399809..2400480 (-)	672	WP_012117978.1	amyloid fiber anchoring/assembly protein TapA	-
ACEYXE_RS11710 (ACEYXE_11710)	-	2400739..2401068 (+)	330	WP_012117979.1	DUF3889 domain-containing protein	-
ACEYXE_RS11715 (ACEYXE_11715)	-	2401108..2401287 (-)	180	WP_003153093.1	YqzE family protein	-
ACEYXE_RS11720 (ACEYXE_11720)	comGG	2401344..2401721 (-)	378	WP_012117980.1	competence type IV pilus minor pilin ComGG	Machinery gene
ACEYXE_RS11725 (ACEYXE_11725)	comGF	2401722..2402222 (-)	501	WP_012117981.1	competence type IV pilus minor pilin ComGF	-
ACEYXE_RS11730 (ACEYXE_11730)	comGE	2402131..2402445 (-)	315	WP_012117982.1	competence type IV pilus minor pilin ComGE	-
ACEYXE_RS11735 (ACEYXE_11735)	comGD	2402429..2402866 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACEYXE_RS11740 (ACEYXE_11740)	comGC	2402856..2403164 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
ACEYXE_RS11745 (ACEYXE_11745)	comGB	2403169..2404206 (-)	1038	WP_012117984.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACEYXE_RS11750 (ACEYXE_11750)	comGA	2404193..2405263 (-)	1071	WP_012117985.1	competence type IV pilus ATPase ComGA	Machinery gene
ACEYXE_RS11755 (ACEYXE_11755)	-	2405460..2406410 (-)	951	WP_007408319.1	magnesium transporter CorA family protein	-
ACEYXE_RS11760 (ACEYXE_11760)	-	2406556..2407857 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1051732 ACEYXE_RS11735 WP_012117983.1 2402429..2402866(-) (comGD) [Bacillus velezensis strain SZ-T8]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1051732 ACEYXE_RS11735 WP_012117983.1 2402429..2402866(-) (comGD) [Bacillus velezensis strain SZ-T8]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACGGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572