Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   ACEYXE_RS11720 Genome accession   NZ_CP169521
Coordinates   2401344..2401721 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain SZ-T8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2396344..2406721
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEYXE_RS11680 (ACEYXE_11680) - 2396842..2397636 (+) 795 WP_012117976.1 YqhG family protein -
  ACEYXE_RS11685 (ACEYXE_11685) sinI 2397813..2397986 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ACEYXE_RS11690 (ACEYXE_11690) sinR 2398020..2398355 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ACEYXE_RS11695 (ACEYXE_11695) tasA 2398403..2399188 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  ACEYXE_RS11700 (ACEYXE_11700) sipW 2399253..2399837 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ACEYXE_RS11705 (ACEYXE_11705) tapA 2399809..2400480 (-) 672 WP_012117978.1 amyloid fiber anchoring/assembly protein TapA -
  ACEYXE_RS11710 (ACEYXE_11710) - 2400739..2401068 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  ACEYXE_RS11715 (ACEYXE_11715) - 2401108..2401287 (-) 180 WP_003153093.1 YqzE family protein -
  ACEYXE_RS11720 (ACEYXE_11720) comGG 2401344..2401721 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  ACEYXE_RS11725 (ACEYXE_11725) comGF 2401722..2402222 (-) 501 WP_012117981.1 competence type IV pilus minor pilin ComGF -
  ACEYXE_RS11730 (ACEYXE_11730) comGE 2402131..2402445 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  ACEYXE_RS11735 (ACEYXE_11735) comGD 2402429..2402866 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  ACEYXE_RS11740 (ACEYXE_11740) comGC 2402856..2403164 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ACEYXE_RS11745 (ACEYXE_11745) comGB 2403169..2404206 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  ACEYXE_RS11750 (ACEYXE_11750) comGA 2404193..2405263 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  ACEYXE_RS11755 (ACEYXE_11755) - 2405460..2406410 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=1051731 ACEYXE_RS11720 WP_012117980.1 2401344..2401721(-) (comGG) [Bacillus velezensis strain SZ-T8]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=1051731 ACEYXE_RS11720 WP_012117980.1 2401344..2401721(-) (comGG) [Bacillus velezensis strain SZ-T8]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512

Multiple sequence alignment