Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ACEYXE_RS11685 | Genome accession | NZ_CP169521 |
| Coordinates | 2397813..2397986 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain SZ-T8 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2392813..2402986
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACEYXE_RS11670 (ACEYXE_11670) | gcvT | 2393626..2394726 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ACEYXE_RS11675 (ACEYXE_11675) | - | 2395150..2396820 (+) | 1671 | WP_012117975.1 | DEAD/DEAH box helicase | - |
| ACEYXE_RS11680 (ACEYXE_11680) | - | 2396842..2397636 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| ACEYXE_RS11685 (ACEYXE_11685) | sinI | 2397813..2397986 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ACEYXE_RS11690 (ACEYXE_11690) | sinR | 2398020..2398355 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ACEYXE_RS11695 (ACEYXE_11695) | tasA | 2398403..2399188 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| ACEYXE_RS11700 (ACEYXE_11700) | sipW | 2399253..2399837 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ACEYXE_RS11705 (ACEYXE_11705) | tapA | 2399809..2400480 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ACEYXE_RS11710 (ACEYXE_11710) | - | 2400739..2401068 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| ACEYXE_RS11715 (ACEYXE_11715) | - | 2401108..2401287 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ACEYXE_RS11720 (ACEYXE_11720) | comGG | 2401344..2401721 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ACEYXE_RS11725 (ACEYXE_11725) | comGF | 2401722..2402222 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| ACEYXE_RS11730 (ACEYXE_11730) | comGE | 2402131..2402445 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| ACEYXE_RS11735 (ACEYXE_11735) | comGD | 2402429..2402866 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1051729 ACEYXE_RS11685 WP_003153105.1 2397813..2397986(+) (sinI) [Bacillus velezensis strain SZ-T8]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1051729 ACEYXE_RS11685 WP_003153105.1 2397813..2397986(+) (sinI) [Bacillus velezensis strain SZ-T8]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |