Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACEY2J_RS14150 Genome accession   NZ_CP169293
Coordinates   2832466..2832936 (+) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain NSA 739     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2804164..2838635 2832466..2832936 within 0


Gene organization within MGE regions


Location: 2804164..2838635
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEY2J_RS13965 (ACEY2J_13965) - 2804164..2804790 (-) 627 WP_000522384.1 nitroreductase family protein -
  ACEY2J_RS13970 (ACEY2J_13970) - 2804987..2806240 (+) 1254 WP_000120307.1 SdrH family protein -
  ACEY2J_RS13975 (ACEY2J_13975) mroQ 2806265..2807008 (-) 744 WP_000197635.1 CPBP family intramembrane glutamic endopeptidase MroQ -
  ACEY2J_RS13980 (ACEY2J_13980) groES 2807183..2807467 (+) 285 WP_000917289.1 co-chaperone GroES -
  ACEY2J_RS13985 (ACEY2J_13985) groL 2807543..2809159 (+) 1617 WP_000240645.1 chaperonin GroEL -
  ACEY2J_RS13990 (ACEY2J_13990) - 2809254..2809800 (-) 547 Protein_2715 site-specific integrase -
  ACEY2J_RS13995 (ACEY2J_13995) - 2809861..2810073 (+) 213 WP_000128898.1 LuxR C-terminal-related transcriptional regulator -
  ACEY2J_RS14000 (ACEY2J_14000) - 2810070..2810660 (+) 591 WP_001293058.1 terminase small subunit -
  ACEY2J_RS14005 (ACEY2J_14005) - 2810979..2811415 (+) 437 Protein_2718 hypothetical protein -
  ACEY2J_RS14010 (ACEY2J_14010) - 2811521..2811964 (+) 444 WP_000022887.1 GNAT family N-acetyltransferase -
  ACEY2J_RS14015 (ACEY2J_14015) - 2812817..2814124 (-) 1308 WP_001045079.1 TrkH family potassium uptake protein -
  ACEY2J_RS14020 (ACEY2J_14020) - 2814285..2815196 (+) 912 WP_000825510.1 iron-hydroxamate ABC transporter substrate-binding protein -
  ACEY2J_RS14025 (ACEY2J_14025) - 2815258..2816102 (+) 845 Protein_2722 class I SAM-dependent methyltransferase -
  ACEY2J_RS14030 (ACEY2J_14030) - 2816474..2817697 (-) 1224 WP_000206638.1 ArgE/DapE family deacylase -
  ACEY2J_RS14035 (ACEY2J_14035) lukH 2818132..2819187 (+) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  ACEY2J_RS14040 (ACEY2J_14040) lukG 2819209..2820225 (+) 1017 WP_000595324.1 bi-component leukocidin LukGH subunit G -
  ACEY2J_RS14045 (ACEY2J_14045) sph 2820448..2821288 (-) 841 Protein_2726 sphingomyelin phosphodiesterase -
  ACEY2J_RS14050 (ACEY2J_14050) - 2821345..2822382 (-) 1038 WP_000857198.1 site-specific integrase -
  ACEY2J_RS14055 (ACEY2J_14055) - 2822555..2823094 (-) 540 WP_000391618.1 type II toxin-antitoxin system PemK/MazF family toxin -
  ACEY2J_RS14060 (ACEY2J_14060) - 2823234..2823401 (-) 168 WP_000705238.1 hypothetical protein -
  ACEY2J_RS14065 (ACEY2J_14065) - 2823601..2823786 (-) 186 WP_001089804.1 hypothetical protein -
  ACEY2J_RS14070 (ACEY2J_14070) - 2823773..2823928 (-) 156 WP_001049399.1 hypothetical protein -
  ACEY2J_RS14075 (ACEY2J_14075) - 2823940..2824647 (-) 708 WP_000094093.1 XRE family transcriptional regulator -
  ACEY2J_RS14080 (ACEY2J_14080) - 2824818..2825057 (+) 240 WP_000548578.1 helix-turn-helix transcriptional regulator -
  ACEY2J_RS14085 (ACEY2J_14085) - 2825070..2825330 (+) 261 WP_000435341.1 transcriptional regulator -
  ACEY2J_RS14090 (ACEY2J_14090) - 2825354..2825893 (-) 540 WP_000351243.1 hypothetical protein -
  ACEY2J_RS14095 (ACEY2J_14095) - 2825950..2826702 (+) 753 WP_001148618.1 phage antirepressor KilAC domain-containing protein -
  ACEY2J_RS14100 (ACEY2J_14100) - 2826719..2826913 (+) 195 WP_000388066.1 hypothetical protein -
  ACEY2J_RS14105 (ACEY2J_14105) - 2826944..2827084 (+) 141 WP_000939496.1 hypothetical protein -
  ACEY2J_RS14110 (ACEY2J_14110) - 2827099..2827731 (-) 633 WP_000275058.1 hypothetical protein -
  ACEY2J_RS14115 (ACEY2J_14115) - 2827790..2828110 (+) 321 WP_001120197.1 DUF771 domain-containing protein -
  ACEY2J_RS14120 (ACEY2J_14120) - 2828107..2828268 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  ACEY2J_RS14125 (ACEY2J_14125) - 2828361..2828621 (+) 261 WP_000291489.1 DUF1108 family protein -
  ACEY2J_RS14130 (ACEY2J_14130) - 2828630..2828893 (+) 264 WP_001205732.1 hypothetical protein -
  ACEY2J_RS14135 (ACEY2J_14135) - 2828902..2830845 (+) 1944 WP_000700565.1 AAA family ATPase -
  ACEY2J_RS14140 (ACEY2J_14140) - 2830847..2831767 (+) 921 WP_000138481.1 recombinase RecT -
  ACEY2J_RS14145 (ACEY2J_14145) - 2831848..2832465 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  ACEY2J_RS14150 (ACEY2J_14150) ssbA 2832466..2832936 (+) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  ACEY2J_RS14155 (ACEY2J_14155) - 2832966..2833850 (+) 885 WP_216765977.1 DnaD domain protein -
  ACEY2J_RS14160 (ACEY2J_14160) - 2833857..2834075 (+) 219 WP_000338528.1 hypothetical protein -
  ACEY2J_RS14165 (ACEY2J_14165) - 2834084..2834488 (+) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  ACEY2J_RS14170 (ACEY2J_14170) - 2834501..2834869 (+) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  ACEY2J_RS14175 (ACEY2J_14175) - 2834873..2835115 (+) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  ACEY2J_RS14180 (ACEY2J_14180) - 2835180..2835629 (+) 450 WP_000982711.1 YopX family protein -
  ACEY2J_RS14185 (ACEY2J_14185) - 2835626..2836135 (+) 510 WP_001105598.1 hypothetical protein -
  ACEY2J_RS14190 (ACEY2J_14190) - 2836132..2836542 (+) 411 WP_000197967.1 hypothetical protein -
  ACEY2J_RS14195 (ACEY2J_14195) - 2836535..2837071 (+) 537 WP_001066444.1 dUTPase -
  ACEY2J_RS14200 (ACEY2J_14200) - 2837108..2837314 (+) 207 WP_000195820.1 DUF1381 domain-containing protein -
  ACEY2J_RS14205 (ACEY2J_14205) rinB 2837311..2837460 (+) 150 WP_000595265.1 transcriptional activator RinB -
  ACEY2J_RS14210 (ACEY2J_14210) - 2837460..2837660 (+) 201 WP_000265039.1 DUF1514 family protein -
  ACEY2J_RS14215 (ACEY2J_14215) - 2837688..2838104 (+) 417 WP_000590126.1 hypothetical protein -
  ACEY2J_RS14220 (ACEY2J_14220) - 2838336..2838635 (+) 300 WP_000988336.1 HNH endonuclease -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=1050277 ACEY2J_RS14150 WP_000934770.1 2832466..2832936(+) (ssbA) [Staphylococcus aureus strain NSA 739]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1050277 ACEY2J_RS14150 WP_000934770.1 2832466..2832936(+) (ssbA) [Staphylococcus aureus strain NSA 739]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment