Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   ACEVB2_RS00410 Genome accession   NZ_CP169223
Coordinates   94817..95245 (-) Length   142 a.a.
NCBI ID   WP_374091644.1    Uniprot ID   -
Organism   Pasteurella multocida subsp. gallicida strain W24_252     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 87173..132177 94817..95245 within 0


Gene organization within MGE regions


Location: 87173..132177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEVB2_RS00345 (ACEVB2_00345) - 87173..87466 (-) 294 WP_061406133.1 addiction module antidote protein -
  ACEVB2_RS00350 (ACEVB2_00350) - 87463..87747 (-) 285 WP_061406134.1 type II toxin-antitoxin system RelE/ParE family toxin -
  ACEVB2_RS00360 (ACEVB2_00360) - 88992..90281 (+) 1290 WP_374091640.1 integrase arm-type DNA-binding domain-containing protein -
  ACEVB2_RS00365 (ACEVB2_00365) - 90262..90438 (-) 177 WP_169326193.1 helix-turn-helix domain-containing protein -
  ACEVB2_RS00370 (ACEVB2_00370) - 90653..90841 (-) 189 WP_169326194.1 hypothetical protein -
  ACEVB2_RS00375 (ACEVB2_00375) - 90844..91287 (-) 444 WP_316728609.1 pyruvate kinase -
  ACEVB2_RS00380 (ACEVB2_00380) - 91343..91849 (-) 507 WP_374091641.1 DUF551 domain-containing protein -
  ACEVB2_RS00385 (ACEVB2_00385) - 91852..92334 (-) 483 WP_324623946.1 class I SAM-dependent methyltransferase -
  ACEVB2_RS00390 (ACEVB2_00390) - 92390..92599 (-) 210 WP_324623942.1 hypothetical protein -
  ACEVB2_RS00395 (ACEVB2_00395) - 92886..93485 (-) 600 WP_374091642.1 hypothetical protein -
  ACEVB2_RS00400 (ACEVB2_00400) - 93542..94330 (-) 789 WP_374091643.1 DUF2303 family protein -
  ACEVB2_RS00405 (ACEVB2_00405) - 94402..94755 (-) 354 WP_016570064.1 hypothetical protein -
  ACEVB2_RS00410 (ACEVB2_00410) ssb 94817..95245 (-) 429 WP_374091644.1 single-stranded DNA-binding protein Machinery gene
  ACEVB2_RS00415 (ACEVB2_00415) - 95246..95521 (-) 276 WP_374091645.1 hypothetical protein -
  ACEVB2_RS00420 (ACEVB2_00420) - 95565..96206 (-) 642 WP_374091646.1 DUF3560 domain-containing protein -
  ACEVB2_RS00425 (ACEVB2_00425) - 96423..96635 (+) 213 WP_151249381.1 hypothetical protein -
  ACEVB2_RS00430 (ACEVB2_00430) - 96604..96834 (-) 231 WP_005720517.1 hypothetical protein -
  ACEVB2_RS00435 (ACEVB2_00435) - 97428..97913 (+) 486 WP_139638712.1 hypothetical protein -
  ACEVB2_RS00440 (ACEVB2_00440) - 98113..98289 (-) 177 WP_169326206.1 hypothetical protein -
  ACEVB2_RS00445 (ACEVB2_00445) - 98611..99561 (-) 951 WP_071171098.1 hypothetical protein -
  ACEVB2_RS00450 (ACEVB2_00450) - 99667..100323 (-) 657 WP_223131937.1 LexA family transcriptional regulator -
  ACEVB2_RS00455 (ACEVB2_00455) - 100453..100659 (+) 207 WP_223131938.1 helix-turn-helix transcriptional regulator -
  ACEVB2_RS00460 (ACEVB2_00460) - 100708..101157 (+) 450 WP_170376550.1 YmfL family putative regulatory protein -
  ACEVB2_RS00465 (ACEVB2_00465) - 101215..101967 (+) 753 WP_374091647.1 Rha family transcriptional regulator -
  ACEVB2_RS00470 (ACEVB2_00470) - 101964..103034 (+) 1071 WP_374091648.1 conserved phage C-terminal domain-containing protein -
  ACEVB2_RS00475 (ACEVB2_00475) - 103043..103576 (+) 534 WP_324624043.1 phage N-6-adenine-methyltransferase -
  ACEVB2_RS00480 (ACEVB2_00480) - 103573..104562 (+) 990 WP_374091649.1 DUF968 domain-containing protein -
  ACEVB2_RS00485 (ACEVB2_00485) - 104562..104936 (+) 375 WP_167829994.1 RusA family crossover junction endodeoxyribonuclease -
  ACEVB2_RS00490 (ACEVB2_00490) - 104923..105309 (+) 387 WP_316728555.1 antiterminator Q family protein -
  ACEVB2_RS00495 (ACEVB2_00495) - 105462..105827 (+) 366 WP_167829996.1 phage holin, lambda family -
  ACEVB2_RS00500 (ACEVB2_00500) - 105799..106383 (+) 585 WP_374091650.1 glycoside hydrolase family 19 protein -
  ACEVB2_RS00505 (ACEVB2_00505) - 106386..106709 (+) 324 WP_316728549.1 DUF2570 family protein -
  ACEVB2_RS00510 (ACEVB2_00510) - 106934..107350 (-) 417 WP_108511501.1 type II toxin-antitoxin system HicB family antitoxin -
  ACEVB2_RS00515 (ACEVB2_00515) - 107398..107574 (-) 177 WP_016533221.1 type II toxin-antitoxin system HicA family toxin -
  ACEVB2_RS00520 (ACEVB2_00520) - 107842..108303 (+) 462 WP_374091651.1 DUF1441 family protein -
  ACEVB2_RS00525 (ACEVB2_00525) - 108284..110392 (+) 2109 WP_374091652.1 phage terminase large subunit family protein -
  ACEVB2_RS00530 (ACEVB2_00530) - 110383..110610 (+) 228 WP_240962717.1 hypothetical protein -
  ACEVB2_RS00535 (ACEVB2_00535) - 110607..112148 (+) 1542 WP_170356815.1 phage portal protein -
  ACEVB2_RS00540 (ACEVB2_00540) - 112081..114108 (+) 2028 WP_374091653.1 ClpP-like prohead protease/major capsid protein fusion protein -
  ACEVB2_RS00545 (ACEVB2_00545) - 114179..114505 (+) 327 WP_005719720.1 DUF2190 family protein -
  ACEVB2_RS00550 (ACEVB2_00550) - 114498..114791 (+) 294 WP_014391484.1 hypothetical protein -
  ACEVB2_RS00555 (ACEVB2_00555) - 114791..115342 (+) 552 WP_374091654.1 phage tail protein -
  ACEVB2_RS00560 (ACEVB2_00560) gpU 115339..115746 (+) 408 WP_374091655.1 phage tail terminator protein -
  ACEVB2_RS00565 (ACEVB2_00565) - 115743..116252 (+) 510 WP_115098329.1 phage tail tube protein -
  ACEVB2_RS00570 (ACEVB2_00570) - 116255..116644 (+) 390 WP_374091656.1 phage tail protein -
  ACEVB2_RS00575 (ACEVB2_00575) - 116665..116967 (+) 303 WP_258553973.1 phage tail assembly protein T -
  ACEVB2_RS00580 (ACEVB2_00580) - 116954..119347 (+) 2394 WP_374091657.1 phage tail length tape measure family protein -
  ACEVB2_RS00585 (ACEVB2_00585) - 119344..119694 (+) 351 WP_374091658.1 phage tail protein -
  ACEVB2_RS00590 (ACEVB2_00590) - 119769..120323 (+) 555 WP_374091659.1 UDP-N-acetylglucosamine acyltransferase -
  ACEVB2_RS00595 (ACEVB2_00595) - 120372..121022 (+) 651 WP_374091660.1 phage minor tail protein L -
  ACEVB2_RS00600 (ACEVB2_00600) - 121024..121737 (+) 714 WP_374091661.1 C40 family peptidase -
  ACEVB2_RS00605 (ACEVB2_00605) - 121670..122389 (+) 720 WP_374091662.1 tail assembly protein -
  ACEVB2_RS00610 (ACEVB2_00610) - 122393..126040 (+) 3648 WP_374091663.1 host specificity protein J -
  ACEVB2_RS00615 (ACEVB2_00615) - 126054..127136 (+) 1083 WP_374091664.1 pyocin knob domain-containing protein -
  ACEVB2_RS00620 (ACEVB2_00620) - 127146..127733 (+) 588 WP_374091665.1 DUF4376 domain-containing protein -
  ACEVB2_RS00625 (ACEVB2_00625) - 127723..127980 (+) 258 WP_005725695.1 hypothetical protein -
  ACEVB2_RS00630 (ACEVB2_00630) - 127995..128441 (-) 447 WP_374091666.1 DUF1870 family protein -
  ACEVB2_RS00635 (ACEVB2_00635) - 128484..128714 (-) 231 WP_099803098.1 hypothetical protein -
  ACEVB2_RS00640 (ACEVB2_00640) - 128871..129551 (-) 681 WP_374091667.1 hypothetical protein -
  ACEVB2_RS00645 (ACEVB2_00645) - 129612..129809 (-) 198 WP_005725436.1 ribbon-helix-helix protein, CopG family -
  ACEVB2_RS00650 (ACEVB2_00650) - 129806..130441 (-) 636 WP_374091668.1 DNA methyltransferase -
  ACEVB2_RS00655 (ACEVB2_00655) - 130438..132177 (-) 1740 WP_374091669.1 DEAD/DEAH box helicase family protein -

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15919.89 Da        Isoelectric Point: 7.2762

>NTDB_id=1049890 ACEVB2_RS00410 WP_374091644.1 94817..95245(-) (ssb) [Pasteurella multocida subsp. gallicida strain W24_252]
MAGVNKVIIVGNLGQDPDHKVMTNGNPVTNISVATSEVWADKASGEKREVVEWHRITLYQRQADIAAQFLKKGSKVYIEG
RLRTRKWQDQNGQDRYITEILADKIVLLDSKQTTGTGNSNPPPEPQQHDPYGDAFKCDNIPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=1049890 ACEVB2_RS00410 WP_374091644.1 94817..95245(-) (ssb) [Pasteurella multocida subsp. gallicida strain W24_252]
ATGGCTGGAGTTAATAAAGTAATTATTGTTGGTAACTTAGGGCAAGACCCCGATCACAAAGTAATGACAAATGGCAATCC
AGTAACCAACATCAGCGTGGCTACAAGTGAAGTGTGGGCTGATAAAGCAAGCGGTGAAAAGCGCGAAGTTGTCGAGTGGC
ACCGTATTACGCTATATCAACGACAAGCAGACATTGCCGCACAGTTTTTGAAAAAAGGCTCAAAAGTTTATATTGAAGGT
CGTTTGCGAACTCGAAAATGGCAAGACCAAAACGGGCAAGATCGCTACATCACAGAAATTCTCGCTGATAAGATCGTCTT
ACTTGATAGCAAGCAGACTACTGGCACTGGTAATAGCAATCCACCACCGGAACCACAGCAACATGATCCGTATGGTGATG
CATTTAAGTGTGACAATATTCCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

66.087

80.986

0.535
  ssb Vibrio cholerae strain A1552

62.626

69.718

0.437
  ssb Neisseria meningitidis MC58

45.614

80.282

0.366
  ssb Neisseria gonorrhoeae MS11

45.614

80.282

0.366

Multiple sequence alignment