Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   ACEPWM_RS10555 Genome accession   NZ_CP168642
Coordinates   2178298..2178768 (-) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain NCCP11854     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2146435..2188863 2178298..2178768 within 0


Gene organization within MGE regions


Location: 2146435..2188863
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACEPWM_RS10345 (ACEPWM_10345) - 2146435..2147271 (-) 837 WP_000675478.1 hypothetical protein -
  ACEPWM_RS10350 (ACEPWM_10350) - 2147887..2149341 (-) 1455 WP_000909210.1 N-acetylmuramoyl-L-alanine amidase -
  ACEPWM_RS10355 (ACEPWM_10355) - 2149352..2149654 (-) 303 WP_000339141.1 phage holin -
  ACEPWM_RS10360 (ACEPWM_10360) - 2149790..2150089 (-) 300 WP_000466784.1 DUF2951 domain-containing protein -
  ACEPWM_RS10365 (ACEPWM_10365) - 2150135..2150299 (-) 165 WP_000916020.1 XkdX family protein -
  ACEPWM_RS10370 (ACEPWM_10370) - 2150292..2150681 (-) 390 WP_001166599.1 DUF2977 domain-containing protein -
  ACEPWM_RS10375 (ACEPWM_10375) - 2150681..2152147 (-) 1467 WP_031900278.1 BppU family phage baseplate upper protein -
  ACEPWM_RS10380 (ACEPWM_10380) - 2152147..2154057 (-) 1911 WP_000429551.1 minor structural protein -
  ACEPWM_RS10385 (ACEPWM_10385) - 2154073..2154363 (-) 291 WP_000179860.1 hypothetical protein -
  ACEPWM_RS10390 (ACEPWM_10390) - 2154363..2155946 (-) 1584 WP_000384462.1 prophage endopeptidase tail family protein -
  ACEPWM_RS10395 (ACEPWM_10395) - 2155955..2156779 (-) 825 WP_001190533.1 phage tail family protein -
  ACEPWM_RS10400 (ACEPWM_10400) - 2156779..2162979 (-) 6201 WP_031900279.1 phage tail tape measure protein -
  ACEPWM_RS10405 (ACEPWM_10405) - 2162993..2163151 (-) 159 WP_000438833.1 hypothetical protein -
  ACEPWM_RS10410 (ACEPWM_10410) gpG 2163202..2163543 (-) 342 WP_000589166.1 phage tail assembly chaperone G -
  ACEPWM_RS10415 (ACEPWM_10415) - 2163601..2164056 (-) 456 WP_000169128.1 Ig-like domain-containing protein -
  ACEPWM_RS10420 (ACEPWM_10420) - 2164148..2164789 (-) 642 WP_000807536.1 major tail protein -
  ACEPWM_RS10425 (ACEPWM_10425) - 2164824..2165219 (-) 396 WP_001023806.1 DUF3168 domain-containing protein -
  ACEPWM_RS10430 (ACEPWM_10430) - 2165220..2165621 (-) 402 WP_000110023.1 hypothetical protein -
  ACEPWM_RS10435 (ACEPWM_10435) - 2165618..2165950 (-) 333 WP_031838176.1 phage protein -
  ACEPWM_RS10440 (ACEPWM_10440) - 2165962..2166240 (-) 279 WP_000050973.1 head-tail connector protein -
  ACEPWM_RS10445 (ACEPWM_10445) - 2166309..2167472 (-) 1164 WP_001142739.1 phage major capsid protein -
  ACEPWM_RS10450 (ACEPWM_10450) - 2167484..2168257 (-) 774 WP_000061872.1 head maturation protease, ClpP-related -
  ACEPWM_RS10455 (ACEPWM_10455) - 2168241..2169479 (-) 1239 WP_001100669.1 phage portal protein -
  ACEPWM_RS10460 (ACEPWM_10460) - 2169484..2171175 (-) 1692 WP_000153549.1 terminase large subunit -
  ACEPWM_RS10465 (ACEPWM_10465) - 2171165..2171470 (-) 306 WP_000778930.1 P27 family phage terminase small subunit -
  ACEPWM_RS10470 (ACEPWM_10470) - 2171597..2171911 (-) 315 WP_000196700.1 HNH endonuclease -
  ACEPWM_RS10475 (ACEPWM_10475) - 2172073..2172510 (-) 438 WP_053507569.1 transcriptional regulator -
  ACEPWM_RS10480 (ACEPWM_10480) - 2172523..2173434 (-) 912 Protein_2013 SNF2-related protein -
  ACEPWM_RS10485 (ACEPWM_10485) - 2173434..2173760 (-) 327 Protein_2014 hypothetical protein -
  ACEPWM_RS10490 (ACEPWM_10490) - 2173812..2174012 (-) 201 WP_000265258.1 DUF1514 family protein -
  ACEPWM_RS10495 (ACEPWM_10495) rinB 2174080..2174232 (-) 153 WP_000237866.1 transcriptional activator RinB -
  ACEPWM_RS10500 (ACEPWM_10500) - 2174235..2174435 (-) 201 WP_001125015.1 hypothetical protein -
  ACEPWM_RS10505 (ACEPWM_10505) - 2174410..2174598 (-) 189 WP_000195823.1 DUF1381 domain-containing protein -
  ACEPWM_RS10510 (ACEPWM_10510) - 2174615..2174788 (-) 174 WP_001209219.1 hypothetical protein -
  ACEPWM_RS10515 (ACEPWM_10515) - 2174825..2175355 (-) 531 WP_235103126.1 dUTPase -
  ACEPWM_RS10520 (ACEPWM_10520) - 2175711..2175836 (-) 126 Protein_2021 DUF1024 family protein -
  ACEPWM_RS10525 (ACEPWM_10525) - 2175851..2176093 (-) 243 WP_000221877.1 SAV1978 family virulence-associated passenger protein -
  ACEPWM_RS10530 (ACEPWM_10530) - 2176096..2176353 (-) 258 WP_000111491.1 DUF3310 domain-containing protein -
  ACEPWM_RS10535 (ACEPWM_10535) - 2176353..2176724 (-) 372 WP_000101279.1 SA1788 family PVL leukocidin-associated protein -
  ACEPWM_RS10540 (ACEPWM_10540) - 2176737..2177141 (-) 405 Protein_2025 RusA family crossover junction endodeoxyribonuclease -
  ACEPWM_RS10545 (ACEPWM_10545) - 2177150..2177368 (-) 219 WP_000338528.1 hypothetical protein -
  ACEPWM_RS10550 (ACEPWM_10550) - 2177375..2178268 (-) 894 WP_000148333.1 DnaD domain-containing protein -
  ACEPWM_RS10555 (ACEPWM_10555) ssbA 2178298..2178768 (-) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  ACEPWM_RS10560 (ACEPWM_10560) - 2178769..2179386 (-) 618 WP_064135358.1 MBL fold metallo-hydrolase -
  ACEPWM_RS10565 (ACEPWM_10565) - 2179467..2180387 (-) 921 WP_000180600.1 recombinase RecT -
  ACEPWM_RS10570 (ACEPWM_10570) - 2180389..2182332 (-) 1944 WP_000700554.1 AAA family ATPase -
  ACEPWM_RS10575 (ACEPWM_10575) - 2182341..2182604 (-) 264 WP_001205732.1 hypothetical protein -
  ACEPWM_RS10580 (ACEPWM_10580) - 2182613..2182873 (-) 261 WP_000291510.1 DUF1108 family protein -
  ACEPWM_RS10585 (ACEPWM_10585) - 2182878..2183180 (-) 303 WP_000165371.1 DUF2482 family protein -
  ACEPWM_RS10590 (ACEPWM_10590) - 2183275..2183436 (-) 162 WP_031833131.1 DUF1270 domain-containing protein -
  ACEPWM_RS10595 (ACEPWM_10595) - 2183448..2183711 (-) 264 WP_001124198.1 helix-turn-helix domain-containing protein -
  ACEPWM_RS10600 (ACEPWM_10600) - 2183738..2183953 (-) 216 WP_001097552.1 hypothetical protein -
  ACEPWM_RS10605 (ACEPWM_10605) - 2184008..2184373 (+) 366 WP_001128433.1 hypothetical protein -
  ACEPWM_RS10610 (ACEPWM_10610) - 2184342..2184587 (-) 246 WP_001025401.1 DUF2829 domain-containing protein -
  ACEPWM_RS10615 (ACEPWM_10615) - 2184616..2185392 (-) 777 WP_001148544.1 Rha family transcriptional regulator -
  ACEPWM_RS10620 (ACEPWM_10620) - 2185408..2185626 (-) 219 WP_001198673.1 helix-turn-helix transcriptional regulator -
  ACEPWM_RS10625 (ACEPWM_10625) - 2185768..2186487 (+) 720 WP_000358224.1 XRE family transcriptional regulator -
  ACEPWM_RS10630 (ACEPWM_10630) - 2186557..2186739 (+) 183 WP_000705240.1 hypothetical protein -
  ACEPWM_RS10635 (ACEPWM_10635) - 2186775..2186921 (+) 147 WP_001013104.1 hypothetical protein -
  ACEPWM_RS10640 (ACEPWM_10640) - 2186918..2187532 (-) 615 WP_000191458.1 hypothetical protein -
  ACEPWM_RS10645 (ACEPWM_10645) - 2187658..2188863 (+) 1206 WP_000264751.1 site-specific integrase -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1044663 ACEPWM_RS10555 WP_000934759.1 2178298..2178768(-) (ssbA) [Staphylococcus aureus strain NCCP11854]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1044663 ACEPWM_RS10555 WP_000934759.1 2178298..2178768(-) (ssbA) [Staphylococcus aureus strain NCCP11854]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment