Detailed information
Bioinformatically predicted
Overview
| Name | comW | Type | Regulator |
| Locus tag | ACD268_RS00215 | Genome accession | NZ_CP168299 |
| Coordinates | 35344..35580 (+) | Length | 78 a.a. |
| NCBI ID | WP_000939545.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain FC1 | ||
| Function | stabilization and activation of ComX (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 25865..85165 | 35344..35580 | within | 0 |
| IScluster/Tn | 34217..35027 | 35344..35580 | flank | 317 |
Gene organization within MGE regions
Location: 25865..85165
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACD268_RS00165 (ACD268_00165) | ftsH | 25865..27823 (+) | 1959 | WP_000744551.1 | ATP-dependent zinc metalloprotease FtsH | - |
| ACD268_RS00170 (ACD268_00170) | comX/comX2 | 27945..28424 (+) | 480 | WP_000588911.1 | sigma-70 family RNA polymerase sigma factor | Regulator |
| ACD268_RS00205 (ACD268_00205) | - | 33973..34182 (+) | 210 | Protein_34 | transposase | - |
| ACD268_RS00210 (ACD268_00210) | - | 34217..35078 (-) | 862 | Protein_35 | transposase | - |
| ACD268_RS00215 (ACD268_00215) | comW | 35344..35580 (+) | 237 | WP_000939545.1 | sigma(X)-activator ComW | Regulator |
| ACD268_RS00220 (ACD268_00220) | - | 35811..37097 (+) | 1287 | WP_000205044.1 | adenylosuccinate synthase | - |
| ACD268_RS00225 (ACD268_00225) | - | 37339..38487 (-) | 1149 | WP_050213885.1 | site-specific integrase | - |
| ACD268_RS00230 (ACD268_00230) | - | 38676..39599 (-) | 924 | WP_000122589.1 | exonuclease domain-containing protein | - |
| ACD268_RS00235 (ACD268_00235) | - | 39612..39995 (-) | 384 | WP_000136455.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACD268_RS00240 (ACD268_00240) | - | 40008..40370 (-) | 363 | WP_000466344.1 | helix-turn-helix domain-containing protein | - |
| ACD268_RS00245 (ACD268_00245) | - | 40748..40969 (-) | 222 | WP_000041097.1 | hypothetical protein | - |
| ACD268_RS00250 (ACD268_00250) | - | 41088..41234 (+) | 147 | WP_000389576.1 | hypothetical protein | - |
| ACD268_RS00255 (ACD268_00255) | - | 41246..41449 (+) | 204 | WP_000032094.1 | helix-turn-helix domain-containing protein | - |
| ACD268_RS00260 (ACD268_00260) | - | 41592..42308 (+) | 717 | WP_001002350.1 | ORF6C domain-containing protein | - |
| ACD268_RS00265 (ACD268_00265) | - | 42321..42578 (+) | 258 | WP_000370959.1 | hypothetical protein | - |
| ACD268_RS00270 (ACD268_00270) | - | 42664..42984 (+) | 321 | WP_000462826.1 | hypothetical protein | - |
| ACD268_RS00275 (ACD268_00275) | - | 43000..43299 (+) | 300 | WP_373381843.1 | hypothetical protein | - |
| ACD268_RS00280 (ACD268_00280) | - | 43290..44078 (+) | 789 | WP_001185498.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ACD268_RS00285 (ACD268_00285) | - | 44066..44224 (+) | 159 | WP_000511766.1 | hypothetical protein | - |
| ACD268_RS00290 (ACD268_00290) | - | 44218..44988 (+) | 771 | WP_000228203.1 | ATP-binding protein | - |
| ACD268_RS00295 (ACD268_00295) | - | 45003..45197 (+) | 195 | WP_000470343.1 | hypothetical protein | - |
| ACD268_RS00300 (ACD268_00300) | - | 45197..45424 (+) | 228 | WP_000891969.1 | hypothetical protein | - |
| ACD268_RS00305 (ACD268_00305) | - | 45551..45715 (+) | 165 | WP_000233201.1 | hypothetical protein | - |
| ACD268_RS00310 (ACD268_00310) | - | 45705..45896 (+) | 192 | WP_001105096.1 | hypothetical protein | - |
| ACD268_RS00315 (ACD268_00315) | - | 45886..46218 (+) | 333 | WP_000875947.1 | hypothetical protein | - |
| ACD268_RS00320 (ACD268_00320) | - | 46190..46507 (+) | 318 | WP_174232533.1 | hypothetical protein | - |
| ACD268_RS00325 (ACD268_00325) | - | 46509..46994 (+) | 486 | WP_075281177.1 | DUF1642 domain-containing protein | - |
| ACD268_RS00330 (ACD268_00330) | - | 46994..47281 (+) | 288 | WP_000616765.1 | hypothetical protein | - |
| ACD268_RS00335 (ACD268_00335) | - | 47398..47862 (+) | 465 | WP_000516820.1 | hypothetical protein | - |
| ACD268_RS00340 (ACD268_00340) | - | 47971..48513 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| ACD268_RS00345 (ACD268_00345) | - | 49054..49260 (+) | 207 | WP_223842409.1 | HNH endonuclease | - |
| ACD268_RS00350 (ACD268_00350) | - | 49397..49882 (+) | 486 | WP_000601030.1 | hypothetical protein | - |
| ACD268_RS00355 (ACD268_00355) | - | 49875..51587 (+) | 1713 | WP_000230006.1 | terminase TerL endonuclease subunit | - |
| ACD268_RS00360 (ACD268_00360) | - | 51596..52738 (+) | 1143 | WP_001812652.1 | phage portal protein | - |
| ACD268_RS00365 (ACD268_00365) | - | 52785..53327 (+) | 543 | WP_000413203.1 | HK97 family phage prohead protease | - |
| ACD268_RS00370 (ACD268_00370) | - | 53342..54595 (+) | 1254 | WP_000855224.1 | phage major capsid protein | - |
| ACD268_RS00375 (ACD268_00375) | - | 54621..54956 (+) | 336 | WP_000154006.1 | hypothetical protein | - |
| ACD268_RS00380 (ACD268_00380) | - | 54953..55258 (+) | 306 | WP_000842790.1 | head-tail adaptor protein | - |
| ACD268_RS00385 (ACD268_00385) | - | 55258..55605 (+) | 348 | WP_001074487.1 | hypothetical protein | - |
| ACD268_RS00390 (ACD268_00390) | - | 55592..55936 (+) | 345 | WP_000534621.1 | hypothetical protein | - |
| ACD268_RS00395 (ACD268_00395) | - | 55950..56618 (+) | 669 | WP_000221469.1 | hypothetical protein | - |
| ACD268_RS00400 (ACD268_00400) | - | 56620..57096 (+) | 477 | WP_000591561.1 | hypothetical protein | - |
| ACD268_RS00405 (ACD268_00405) | - | 57283..60021 (+) | 2739 | WP_000852167.1 | phage tail tape measure protein | - |
| ACD268_RS00410 (ACD268_00410) | - | 60018..60740 (+) | 723 | Protein_75 | phage tail protein | - |
| ACD268_RS00415 (ACD268_00415) | - | 60831..61643 (+) | 813 | Protein_76 | phage tail spike protein | - |
| ACD268_RS00420 (ACD268_00420) | - | 61869..68207 (+) | 6339 | WP_373382317.1 | tail fiber domain-containing protein | - |
| ACD268_RS00425 (ACD268_00425) | - | 68204..68320 (+) | 117 | Protein_78 | dihydrodipicolinate reductase | - |
| ACD268_RS00430 (ACD268_00430) | - | 68301..68504 (+) | 204 | WP_001091107.1 | hypothetical protein | - |
| ACD268_RS00435 (ACD268_00435) | - | 68507..68857 (+) | 351 | WP_000852249.1 | hypothetical protein | - |
| ACD268_RS00440 (ACD268_00440) | - | 68867..69283 (+) | 417 | WP_001165344.1 | phage holin family protein | - |
| ACD268_RS00445 (ACD268_00445) | - | 69287..69619 (+) | 333 | WP_001186206.1 | phage holin | - |
| ACD268_RS00450 (ACD268_00450) | - | 69623..70579 (+) | 957 | WP_373381844.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ACD268_RS00455 (ACD268_00455) | - | 70717..70896 (-) | 180 | WP_001209433.1 | hypothetical protein | - |
| ACD268_RS00460 (ACD268_00460) | - | 71038..71187 (-) | 150 | WP_001030863.1 | hypothetical protein | - |
| ACD268_RS00465 (ACD268_00465) | tadA | 71468..71935 (+) | 468 | WP_000291870.1 | tRNA adenosine(34) deaminase TadA | - |
| ACD268_RS00475 (ACD268_00475) | - | 72122..72565 (+) | 444 | WP_000701992.1 | dUTP diphosphatase | - |
| ACD268_RS00480 (ACD268_00480) | - | 72567..73082 (+) | 516 | WP_000691236.1 | histidine phosphatase family protein | - |
| ACD268_RS00485 (ACD268_00485) | radA | 73096..74457 (+) | 1362 | WP_078139281.1 | DNA repair protein RadA | Machinery gene |
| ACD268_RS00490 (ACD268_00490) | - | 74530..75027 (+) | 498 | WP_001809263.1 | carbonic anhydrase | - |
| ACD268_RS00495 (ACD268_00495) | - | 75052..75867 (+) | 816 | WP_000749763.1 | PrsW family intramembrane metalloprotease | - |
| ACD268_RS00500 (ACD268_00500) | - | 76012..76980 (+) | 969 | WP_000010163.1 | ribose-phosphate diphosphokinase | - |
| ACD268_RS00505 (ACD268_00505) | - | 77114..77395 (-) | 282 | Protein_93 | ISL3 family transposase | - |
| ACD268_RS00510 (ACD268_00510) | - | 77522..78429 (-) | 908 | Protein_94 | Rpn family recombination-promoting nuclease/putative transposase | - |
| ACD268_RS00515 (ACD268_00515) | polA | 78685..81318 (+) | 2634 | WP_057484921.1 | DNA polymerase I | - |
| ACD268_RS00520 (ACD268_00520) | - | 81403..81840 (+) | 438 | WP_000076479.1 | CoA-binding protein | - |
| ACD268_RS00525 (ACD268_00525) | - | 81881..82051 (+) | 171 | WP_050211817.1 | hypothetical protein | - |
| ACD268_RS00530 (ACD268_00530) | - | 82070..83080 (-) | 1011 | WP_050079636.1 | YeiH family protein | - |
| ACD268_RS00535 (ACD268_00535) | - | 83229..84398 (+) | 1170 | WP_373381845.1 | pyridoxal phosphate-dependent aminotransferase | - |
| ACD268_RS00540 (ACD268_00540) | recO | 84395..85165 (+) | 771 | WP_000616167.1 | DNA repair protein RecO | - |
Sequence
Protein
Download Length: 78 a.a. Molecular weight: 9658.13 Da Isoelectric Point: 6.7051
>NTDB_id=1043688 ACD268_RS00215 WP_000939545.1 35344..35580(+) (comW) [Streptococcus pneumoniae strain FC1]
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
MLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC
Nucleotide
Download Length: 237 bp
>NTDB_id=1043688 ACD268_RS00215 WP_000939545.1 35344..35580(+) (comW) [Streptococcus pneumoniae strain FC1]
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
ATGTTACAAAAAATTTATGAGCAGATGGCTAATTTCTATGATAGTATTGAAGAAGAGTATGGTCCTACATTTGGTGATAA
TTTTGACTGGGAACATGTTCATTTTAAATTTTTAATTTATTATTTAGTGAGATATGGCATTGGTTGTCGTAAGGATTTTA
TTGTTTACCATTATCGTGTTGCTTATCGTTTGTATCTTGAAAAATTGGTAATGAATCGGGGTTTTATTTCTTGTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comW | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| comW | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comW | Streptococcus mitis SK321 |
75.641 |
100 |
0.756 |
| comW | Streptococcus mitis NCTC 12261 |
75.325 |
98.718 |
0.744 |