Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACDZ07_RS04235 | Genome accession | NZ_CP168012 |
| Coordinates | 868095..868565 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain sa230905_barcode06 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 856458..906478 | 868095..868565 | within | 0 |
Gene organization within MGE regions
Location: 856458..906478
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACDZ07_RS04145 (ACDZ07_04145) | sufB | 856458..857855 (+) | 1398 | WP_001074405.1 | Fe-S cluster assembly protein SufB | - |
| ACDZ07_RS04150 (ACDZ07_04150) | - | 857923..858972 (-) | 1050 | WP_001145728.1 | tyrosine-type recombinase/integrase | - |
| ACDZ07_RS04155 (ACDZ07_04155) | - | 859035..859550 (-) | 516 | WP_054192951.1 | hypothetical protein | - |
| ACDZ07_RS04160 (ACDZ07_04160) | - | 859554..860054 (-) | 501 | WP_000896616.1 | hypothetical protein | - |
| ACDZ07_RS04165 (ACDZ07_04165) | - | 860105..860743 (-) | 639 | WP_000874710.1 | XRE family transcriptional regulator | - |
| ACDZ07_RS04170 (ACDZ07_04170) | - | 860933..861187 (+) | 255 | WP_001106625.1 | helix-turn-helix domain-containing protein | - |
| ACDZ07_RS04175 (ACDZ07_04175) | - | 861203..861520 (+) | 318 | WP_033843167.1 | hypothetical protein | - |
| ACDZ07_RS04180 (ACDZ07_04180) | - | 861675..862466 (+) | 792 | WP_257239794.1 | phage antirepressor KilAC domain-containing protein | - |
| ACDZ07_RS04185 (ACDZ07_04185) | tscA | 862467..862691 (+) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| ACDZ07_RS04190 (ACDZ07_04190) | - | 862731..863180 (+) | 450 | WP_025920885.1 | hypothetical protein | - |
| ACDZ07_RS04195 (ACDZ07_04195) | - | 863194..863415 (+) | 222 | WP_000594793.1 | hypothetical protein | - |
| ACDZ07_RS04200 (ACDZ07_04200) | - | 863408..863575 (+) | 168 | WP_033843162.1 | DUF1270 domain-containing protein | - |
| ACDZ07_RS04205 (ACDZ07_04205) | - | 863576..863896 (+) | 321 | WP_033843163.1 | hypothetical protein | - |
| ACDZ07_RS04210 (ACDZ07_04210) | - | 863990..864250 (+) | 261 | WP_000291075.1 | DUF1108 family protein | - |
| ACDZ07_RS04215 (ACDZ07_04215) | - | 864259..864522 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| ACDZ07_RS04220 (ACDZ07_04220) | - | 864519..866474 (+) | 1956 | WP_049948286.1 | AAA family ATPase | - |
| ACDZ07_RS04225 (ACDZ07_04225) | - | 866476..867396 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| ACDZ07_RS04230 (ACDZ07_04230) | - | 867477..868094 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| ACDZ07_RS04235 (ACDZ07_04235) | ssbA | 868095..868565 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| ACDZ07_RS04240 (ACDZ07_04240) | - | 868595..869512 (+) | 918 | WP_420173084.1 | DnaD domain protein | - |
| ACDZ07_RS04245 (ACDZ07_04245) | - | 869519..869737 (+) | 219 | WP_000338531.1 | hypothetical protein | - |
| ACDZ07_RS04250 (ACDZ07_04250) | - | 869746..870055 (+) | 310 | Protein_825 | RusA family crossover junction endodeoxyribonuclease | - |
| ACDZ07_RS04255 (ACDZ07_04255) | - | 870068..870436 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| ACDZ07_RS04260 (ACDZ07_04260) | - | 870440..870682 (+) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| ACDZ07_RS04265 (ACDZ07_04265) | - | 870697..870948 (+) | 252 | WP_001065046.1 | DUF1024 family protein | - |
| ACDZ07_RS04270 (ACDZ07_04270) | - | 870938..871111 (+) | 174 | WP_000028424.1 | hypothetical protein | - |
| ACDZ07_RS04275 (ACDZ07_04275) | - | 871112..871393 (+) | 282 | WP_000454994.1 | hypothetical protein | - |
| ACDZ07_RS04280 (ACDZ07_04280) | - | 871394..871555 (+) | 162 | WP_000889683.1 | hypothetical protein | - |
| ACDZ07_RS04285 (ACDZ07_04285) | - | 871570..872097 (+) | 528 | WP_072473165.1 | dUTPase | - |
| ACDZ07_RS04290 (ACDZ07_04290) | - | 872134..872340 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| ACDZ07_RS04295 (ACDZ07_04295) | - | 872337..872723 (+) | 387 | WP_234101273.1 | DUF1523 family protein | - |
| ACDZ07_RS04300 (ACDZ07_04300) | rinB | 872720..872893 (+) | 174 | WP_223671374.1 | transcriptional activator RinB | - |
| ACDZ07_RS04305 (ACDZ07_04305) | - | 872894..873040 (+) | 147 | WP_000990006.1 | hypothetical protein | - |
| ACDZ07_RS04310 (ACDZ07_04310) | - | 873055..873474 (+) | 420 | WP_000058632.1 | transcriptional regulator | - |
| ACDZ07_RS04315 (ACDZ07_04315) | - | 873661..874155 (+) | 495 | WP_001038245.1 | terminase small subunit | - |
| ACDZ07_RS04320 (ACDZ07_04320) | - | 874158..875453 (+) | 1296 | WP_000273012.1 | PBSX family phage terminase large subunit | - |
| ACDZ07_RS04325 (ACDZ07_04325) | - | 875464..876999 (+) | 1536 | WP_223671373.1 | phage portal protein | - |
| ACDZ07_RS04330 (ACDZ07_04330) | - | 877006..878001 (+) | 996 | WP_001668346.1 | minor capsid protein | - |
| ACDZ07_RS04335 (ACDZ07_04335) | - | 878074..878244 (+) | 171 | WP_033842386.1 | hypothetical protein | - |
| ACDZ07_RS04340 (ACDZ07_04340) | - | 878269..878359 (+) | 91 | Protein_843 | hypothetical protein | - |
| ACDZ07_RS04345 (ACDZ07_04345) | - | 878353..878973 (+) | 621 | WP_070014296.1 | DUF4355 domain-containing protein | - |
| ACDZ07_RS04350 (ACDZ07_04350) | - | 878987..879961 (+) | 975 | WP_033842668.1 | phage major capsid protein | - |
| ACDZ07_RS04355 (ACDZ07_04355) | - | 879983..880270 (+) | 288 | WP_031786118.1 | hypothetical protein | - |
| ACDZ07_RS04360 (ACDZ07_04360) | - | 880279..880611 (+) | 333 | WP_053870257.1 | phage head-tail connector protein | - |
| ACDZ07_RS04365 (ACDZ07_04365) | - | 880608..880910 (+) | 303 | WP_053870256.1 | hypothetical protein | - |
| ACDZ07_RS04370 (ACDZ07_04370) | - | 880910..881257 (+) | 348 | WP_053870255.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACDZ07_RS04375 (ACDZ07_04375) | - | 881269..881652 (+) | 384 | WP_057520528.1 | hypothetical protein | - |
| ACDZ07_RS04380 (ACDZ07_04380) | - | 881671..882252 (+) | 582 | WP_033853501.1 | phage major tail protein, TP901-1 family | - |
| ACDZ07_RS04385 (ACDZ07_04385) | - | 882315..882680 (+) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| ACDZ07_RS04390 (ACDZ07_04390) | - | 882710..883054 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| ACDZ07_RS04395 (ACDZ07_04395) | - | 883071..886538 (+) | 3468 | WP_238610706.1 | phage tail protein | - |
| ACDZ07_RS04400 (ACDZ07_04400) | - | 886551..887498 (+) | 948 | WP_031793849.1 | phage tail family protein | - |
| ACDZ07_RS04405 (ACDZ07_04405) | - | 887507..889408 (+) | 1902 | WP_223671371.1 | SGNH/GDSL hydrolase family protein | - |
| ACDZ07_RS04410 (ACDZ07_04410) | - | 889423..891333 (+) | 1911 | WP_257239823.1 | hypothetical protein | - |
| ACDZ07_RS04415 (ACDZ07_04415) | - | 891333..893156 (+) | 1824 | WP_070014301.1 | phage baseplate upper protein | - |
| ACDZ07_RS04420 (ACDZ07_04420) | - | 893156..893533 (+) | 378 | WP_070014302.1 | DUF2977 domain-containing protein | - |
| ACDZ07_RS04425 (ACDZ07_04425) | - | 893537..893710 (+) | 174 | WP_223671369.1 | XkdX family protein | - |
| ACDZ07_RS04430 (ACDZ07_04430) | - | 893751..894050 (+) | 300 | WP_053868929.1 | DUF2951 domain-containing protein | - |
| ACDZ07_RS04435 (ACDZ07_04435) | - | 894184..896082 (+) | 1899 | WP_107396523.1 | glucosaminidase domain-containing protein | - |
| ACDZ07_RS04440 (ACDZ07_04440) | - | 896095..897267 (+) | 1173 | WP_107396524.1 | BppU family phage baseplate upper protein | - |
| ACDZ07_RS04445 (ACDZ07_04445) | - | 897273..897668 (+) | 396 | WP_000398860.1 | hypothetical protein | - |
| ACDZ07_RS04450 (ACDZ07_04450) | - | 897724..898161 (+) | 438 | WP_038805694.1 | phage holin | - |
| ACDZ07_RS04455 (ACDZ07_04455) | - | 898142..899587 (+) | 1446 | WP_420173085.1 | SH3 domain-containing protein | - |
| ACDZ07_RS04460 (ACDZ07_04460) | - | 899977..900327 (+) | 351 | WP_000448198.1 | hypothetical protein | - |
| ACDZ07_RS04465 (ACDZ07_04465) | - | 900387..900563 (+) | 177 | WP_001823160.1 | hypothetical protein | - |
| ACDZ07_RS04470 (ACDZ07_04470) | - | 900560..901015 (+) | 456 | WP_000971220.1 | hypothetical protein | - |
| ACDZ07_RS04475 (ACDZ07_04475) | - | 901460..901599 (+) | 140 | Protein_870 | hypothetical protein | - |
| ACDZ07_RS04480 (ACDZ07_04480) | - | 901605..901919 (-) | 315 | WP_000274029.1 | hypothetical protein | - |
| ACDZ07_RS04485 (ACDZ07_04485) | - | 902284..903324 (+) | 1041 | WP_000582326.1 | hemolysin family protein | - |
| ACDZ07_RS04490 (ACDZ07_04490) | - | 903338..904405 (+) | 1068 | WP_000267236.1 | NAD(P)H-dependent flavin oxidoreductase | - |
| ACDZ07_RS04495 (ACDZ07_04495) | - | 904659..904742 (+) | 84 | WP_016170465.1 | hypothetical protein | - |
| ACDZ07_RS04500 (ACDZ07_04500) | - | 904790..905638 (+) | 849 | WP_000608129.1 | DUF72 domain-containing protein | - |
| ACDZ07_RS04505 (ACDZ07_04505) | - | 905651..906478 (+) | 828 | WP_000927632.1 | sulfite exporter TauE/SafE family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=1041148 ACDZ07_RS04235 WP_000934770.1 868095..868565(+) (ssbA) [Staphylococcus aureus strain sa230905_barcode06]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1041148 ACDZ07_RS04235 WP_000934770.1 868095..868565(+) (ssbA) [Staphylococcus aureus strain sa230905_barcode06]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |