Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   KJP68_RS16365 Genome accession   NZ_OX419559
Coordinates   3136399..3136539 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis isolate NRS6099     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3131399..3141539
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KJP68_RS16340 (NRS6099_16205) yuxO 3131676..3132056 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  KJP68_RS16345 (NRS6099_16210) comA 3132075..3132719 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  KJP68_RS16350 (NRS6099_16215) comP 3132800..3135112 (-) 2313 WP_069703660.1 histidine kinase Regulator
  KJP68_RS16355 (NRS6099_16220) comX 3135128..3135349 (-) 222 WP_014480704.1 competence pheromone ComX -
  KJP68_RS16360 (NRS6099_16225) comQ 3135351..3136214 (-) 864 WP_043858576.1 polyprenyl synthetase family protein Regulator
  KJP68_RS16365 (NRS6099_16230) degQ 3136399..3136539 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  KJP68_RS16370 - 3136761..3136823 (+) 63 Protein_3159 hypothetical protein -
  KJP68_RS16375 (NRS6099_16235) - 3137001..3137369 (+) 369 WP_017695529.1 hypothetical protein -
  KJP68_RS16380 (NRS6099_16240) pdeH 3137345..3138574 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  KJP68_RS16385 (NRS6099_16245) pncB 3138711..3140183 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  KJP68_RS16390 (NRS6099_16250) pncA 3140199..3140750 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  KJP68_RS16395 (NRS6099_16255) yueI 3140847..3141245 (-) 399 WP_032726794.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=1039416 KJP68_RS16365 WP_003220708.1 3136399..3136539(-) (degQ) [Bacillus subtilis isolate NRS6099]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1039416 KJP68_RS16365 WP_003220708.1 3136399..3136539(-) (degQ) [Bacillus subtilis isolate NRS6099]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment