Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   KHU1_RS00970 Genome accession   NZ_CP007242
Coordinates   219060..219179 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   A7Z1C5
Organism   Bacillus amyloliquefaciens KHG19     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 214060..224179
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHU1_RS00955 (KHU1_0186) - 215672..216355 (+) 684 WP_042634825.1 response regulator transcription factor -
  KHU1_RS00960 (KHU1_0187) - 216342..217775 (+) 1434 WP_162183162.1 sensor histidine kinase -
  KHU1_RS00965 (KHU1_0188) rapC 217928..219076 (+) 1149 WP_007410270.1 Rap family tetratricopeptide repeat protein Regulator
  KHU1_RS00970 (KHU1_0189) phrC 219060..219179 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  KHU1_RS19195 - 219327..219437 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  KHU1_RS00975 (KHU1_0190) - 219517..220881 (-) 1365 WP_042634827.1 aspartate kinase -
  KHU1_RS00980 (KHU1_0191) ceuB 221295..222248 (+) 954 WP_015239156.1 ABC transporter permease Machinery gene
  KHU1_RS00985 (KHU1_0192) - 222238..223185 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  KHU1_RS00990 (KHU1_0193) - 223179..223937 (+) 759 WP_003156330.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=103570 KHU1_RS00970 WP_003156334.1 219060..219179(+) (phrC) [Bacillus amyloliquefaciens KHG19]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=103570 KHU1_RS00970 WP_003156334.1 219060..219179(+) (phrC) [Bacillus amyloliquefaciens KHG19]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z1C5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718


Multiple sequence alignment