Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AB3239_RS21685 Genome accession   NZ_CP166831
Coordinates   4163113..4163631 (-) Length   172 a.a.
NCBI ID   WP_003219228.1    Uniprot ID   A0A063XE16
Organism   Bacillus subtilis strain TE3T-UV25     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4115891..4163098 4163113..4163631 flank 15


Gene organization within MGE regions


Location: 4115891..4163631
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3239_RS21395 (AB3239_21395) yybO 4116306..4117616 (+) 1311 WP_014478548.1 MFS transporter -
  AB3239_RS21400 (AB3239_21400) - 4117777..4118514 (+) 738 WP_021481086.1 MerR family transcriptional regulator -
  AB3239_RS21405 (AB3239_21405) - 4118552..4119340 (-) 789 WP_032724980.1 hypothetical protein -
  AB3239_RS21410 (AB3239_21410) - 4119436..4119720 (+) 285 Protein_4160 pentapeptide repeat-containing protein -
  AB3239_RS21415 (AB3239_21415) yybF 4119753..4120967 (-) 1215 WP_370957106.1 MFS transporter -
  AB3239_RS21420 (AB3239_21420) yybE 4121155..4122033 (+) 879 WP_161621085.1 LysR family transcriptional regulator -
  AB3239_RS21425 (AB3239_21425) yybD 4122047..4122490 (+) 444 WP_021481090.1 GNAT family N-acetyltransferase -
  AB3239_RS21430 (AB3239_21430) yybC 4122573..4123051 (+) 479 Protein_4164 DUF2798 domain-containing protein -
  AB3239_RS21435 (AB3239_21435) - 4123076..4123218 (-) 143 Protein_4165 LysR family transcriptional regulator -
  AB3239_RS21440 (AB3239_21440) yybB 4123226..4123888 (-) 663 WP_032724976.1 MBL fold metallo-hydrolase -
  AB3239_RS21445 (AB3239_21445) yybA 4124018..4124470 (-) 453 WP_370957107.1 MarR family transcriptional regulator -
  AB3239_RS21450 (AB3239_21450) yyaT 4124590..4125036 (+) 447 WP_032724974.1 GNAT family N-acetyltransferase -
  AB3239_RS21455 (AB3239_21455) yyaS 4125033..4125635 (+) 603 WP_072173947.1 YitT family protein -
  AB3239_RS21460 (AB3239_21460) satA 4125703..4126224 (-) 522 WP_167568405.1 streptothricin N-acetyltransferase SatA -
  AB3239_RS21465 (AB3239_21465) yyaQ 4126622..4126978 (+) 357 WP_338731849.1 MmcQ/YjbR family DNA-binding protein -
  AB3239_RS21470 (AB3239_21470) yyaP 4127139..4127705 (+) 567 WP_021481097.1 dihydrofolate reductase family protein -
  AB3239_RS21475 (AB3239_21475) - 4127947..4128127 (+) 181 Protein_4173 DUF255 domain-containing protein -
  AB3239_RS21480 (AB3239_21480) - 4128241..4128441 (-) 201 WP_072173949.1 hypothetical protein -
  AB3239_RS21485 (AB3239_21485) yyaN 4128781..4129197 (+) 417 WP_010886646.1 MerR family transcriptional regulator -
  AB3239_RS21490 (AB3239_21490) yyaM 4129194..4130111 (+) 918 WP_151869937.1 DMT family transporter -
  AB3239_RS21495 (AB3239_21495) - 4130183..4130350 (+) 168 Protein_4177 DUF255 domain-containing protein -
  AB3239_RS21500 (AB3239_21500) - 4130419..4132377 (-) 1959 WP_370957108.1 NACHT domain-containing NTPase -
  AB3239_RS21505 (AB3239_21505) - 4132465..4133973 (+) 1509 WP_370957109.1 recombinase family protein -
  AB3239_RS21510 (AB3239_21510) - 4134122..4134745 (-) 624 WP_370957110.1 hypothetical protein -
  AB3239_RS21515 (AB3239_21515) - 4134829..4135002 (+) 174 WP_167560883.1 hypothetical protein -
  AB3239_RS21520 (AB3239_21520) - 4135168..4135545 (-) 378 WP_187957475.1 cystatin-like fold lipoprotein -
  AB3239_RS21525 (AB3239_21525) - 4135608..4136114 (-) 507 WP_370957111.1 hypothetical protein -
  AB3239_RS21530 (AB3239_21530) - 4136129..4137118 (-) 990 WP_144482757.1 bifunctional lytic transglycosylase/C40 family peptidase -
  AB3239_RS21535 (AB3239_21535) - 4137115..4139553 (-) 2439 WP_370957112.1 CD3337/EF1877 family mobilome membrane protein -
  AB3239_RS21540 (AB3239_21540) - 4139557..4139883 (-) 327 WP_041904620.1 YddF family protein -
  AB3239_RS21545 (AB3239_21545) conE 4139901..4142396 (-) 2496 WP_370957113.1 VirB4-like ATPase ConE -
  AB3239_RS21550 (AB3239_21550) - 4142284..4142808 (-) 525 WP_370957114.1 conjugal transfer protein -
  AB3239_RS21555 (AB3239_21555) - 4142821..4143069 (-) 249 WP_209283711.1 hypothetical protein -
  AB3239_RS21560 (AB3239_21560) - 4143081..4144145 (-) 1065 WP_370957115.1 conjugal transfer protein -
  AB3239_RS21565 (AB3239_21565) - 4144173..4144322 (-) 150 WP_370957116.1 hypothetical protein -
  AB3239_RS21570 (AB3239_21570) - 4144340..4144618 (-) 279 WP_370957117.1 hypothetical protein -
  AB3239_RS21575 (AB3239_21575) - 4144635..4144901 (-) 267 WP_326218744.1 hypothetical protein -
  AB3239_RS21580 (AB3239_21580) - 4145032..4145886 (+) 855 WP_326218745.1 hypothetical protein -
  AB3239_RS21585 (AB3239_21585) nicK 4146308..4147366 (-) 1059 WP_370957118.1 DNA relaxase NicK -
  AB3239_RS21590 (AB3239_21590) conQ 4147359..4148801 (-) 1443 WP_328037839.1 coupling conjugation protein ConQ -
  AB3239_RS21595 (AB3239_21595) - 4148838..4149215 (-) 378 WP_128473637.1 YdcP family protein -
  AB3239_RS21600 (AB3239_21600) - 4149260..4149376 (-) 117 Protein_4198 hypothetical protein -
  AB3239_RS21605 (AB3239_21605) - 4149582..4149842 (-) 261 WP_124073393.1 hypothetical protein -
  AB3239_RS21610 (AB3239_21610) - 4149896..4150120 (-) 225 WP_370957469.1 hypothetical protein -
  AB3239_RS21615 (AB3239_21615) - 4150153..4150332 (-) 180 WP_017418449.1 hypothetical protein -
  AB3239_RS21620 (AB3239_21620) - 4150627..4151010 (+) 384 WP_370957119.1 helix-turn-helix domain-containing protein -
  AB3239_RS21625 (AB3239_21625) - 4151007..4151537 (+) 531 WP_019716392.1 ImmA/IrrE family metallo-endopeptidase -
  AB3239_RS21630 (AB3239_21630) - 4151651..4152847 (-) 1197 WP_370957120.1 Rap family tetratricopeptide repeat protein -
  AB3239_RS21635 (AB3239_21635) - 4153143..4154459 (+) 1317 WP_370957121.1 serine/threonine-protein kinase -
  AB3239_RS21640 (AB3239_21640) - 4154559..4155368 (+) 810 WP_370957122.1 hypothetical protein -
  AB3239_RS21645 (AB3239_21645) yyaL 4155402..4157492 (+) 2091 Protein_4207 thioredoxin domain-containing protein -
  AB3239_RS21650 (AB3239_21650) yyaK 4157489..4158388 (-) 900 WP_021481102.1 CPBP family intramembrane glutamic endopeptidase -
  AB3239_RS21655 (AB3239_21655) yyaJ 4158615..4159970 (+) 1356 WP_370957123.1 MFS transporter -
  AB3239_RS21660 (AB3239_21660) maa 4160004..4160558 (-) 555 WP_015250785.1 sugar O-acetyltransferase -
  AB3239_RS21665 (AB3239_21665) yyaH 4160576..4160956 (-) 381 WP_003244460.1 VOC family protein -
  AB3239_RS21670 (AB3239_21670) ccpB 4161012..4161947 (-) 936 WP_370957124.1 transcriptional regulator CcpB -
  AB3239_RS21675 (AB3239_21675) xth 4162007..4162765 (-) 759 WP_141949356.1 exodeoxyribonuclease III -
  AB3239_RS21680 (AB3239_21680) rpsR 4162830..4163069 (-) 240 WP_003219224.1 30S ribosomal protein S18 -
  AB3239_RS21685 (AB3239_21685) ssbA 4163113..4163631 (-) 519 WP_003219228.1 single-stranded DNA-binding protein SsbA Machinery gene

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18742.31 Da        Isoelectric Point: 4.7621

>NTDB_id=1035570 AB3239_RS21685 WP_003219228.1 4163113..4163631(-) (ssbA) [Bacillus subtilis strain TE3T-UV25]
MLNRVVLVGRLTKDPELRYTPNGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNGGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=1035570 AB3239_RS21685 WP_003219228.1 4163113..4163631(-) (ssbA) [Bacillus subtilis strain TE3T-UV25]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAACGGTGCGGCTGTTGC
TACGTTTACTCTTGCTGTGAATCGTACATTTACGAACCAGTCCGGAGAACGTGAGGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTCTTGAAAAAAGGAAGCCTTGCAGGCGTAGATGGCCGTTTACAAACAAGA
AACTATGAAAACCAGCAAGGACAGCGTGTCTTCGTGACAGAGGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCGAAAAA
CGGCGGCGGTTCTGGTTCAGGTGGATACAACGAAGGAAACAGCGGCGGAGGCCAGTACTTTGGCGGAGGCCAAAATGATA
ATCCATTTGGGGGAAATCAAAACAACCAGAGACGCAATCAGGGGAACAGCTTTAATGATGACCCATTTGCCAACGACGGC
AAACCGATTGACATCTCGGATGATGATCTTCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063XE16

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

100

100

1

  ssb Latilactobacillus sakei subsp. sakei 23K

58.192

100

0.599

  ssbB Bacillus subtilis subsp. subtilis str. 168

64.151

61.628

0.395

  ssb Glaesserella parasuis strain SC1401

35.519

100

0.378


Multiple sequence alignment