Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   AB6911_RS13405 Genome accession   NZ_CP166481
Coordinates   2623887..2624282 (-) Length   131 a.a.
NCBI ID   WP_309484978.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain globigii     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2618887..2629282
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6911_RS13365 (AB6911_13345) sinI 2619794..2619967 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  AB6911_RS13370 (AB6911_13350) sinR 2620001..2620336 (+) 336 WP_003325441.1 transcriptional regulator SinR Regulator
  AB6911_RS13375 (AB6911_13355) tasA 2620528..2621310 (-) 783 WP_003325439.1 biofilm matrix protein TasA -
  AB6911_RS13380 (AB6911_13360) sipW 2621374..2621946 (-) 573 WP_010789195.1 signal peptidase I SipW -
  AB6911_RS13385 (AB6911_13365) tapA 2621930..2622631 (-) 702 WP_003325437.1 amyloid fiber anchoring/assembly protein TapA -
  AB6911_RS13390 (AB6911_13370) - 2622893..2623216 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  AB6911_RS13395 (AB6911_13375) - 2623263..2623442 (-) 180 WP_003325435.1 YqzE family protein -
  AB6911_RS13400 (AB6911_13380) comGG 2623512..2623886 (-) 375 WP_003325434.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB6911_RS13405 (AB6911_13385) comGF 2623887..2624282 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  AB6911_RS13410 (AB6911_13390) comGE 2624296..2624643 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB6911_RS13415 (AB6911_13395) comGD 2624627..2625067 (-) 441 WP_003325431.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB6911_RS13420 (AB6911_13400) comGC 2625057..2625356 (-) 300 WP_003325429.1 competence type IV pilus major pilin ComGC Machinery gene
  AB6911_RS13425 (AB6911_13405) comGB 2625371..2626408 (-) 1038 WP_003325428.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB6911_RS13430 (AB6911_13410) comGA 2626395..2627465 (-) 1071 WP_003325427.1 competence type IV pilus ATPase ComGA Machinery gene
  AB6911_RS13435 (AB6911_13415) - 2627882..2628835 (-) 954 WP_003325425.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 131 a.a.        Molecular weight: 14825.21 Da        Isoelectric Point: 8.4718

>NTDB_id=1034673 AB6911_RS13405 WP_309484978.1 2623887..2624282(-) (comGF) [Bacillus atrophaeus strain globigii]
MSVYLLISGSLAMIFYQFLSRQLEGEGVKQEEWIISVEQMMNECKQAESVQLTDKGGGVLCRNGSGREILFEKYHKMIRK
RVDGKGHVPILQHINTLKADIKNGMLILSVTSEDHKEYKTSFPIYTSLKGG

Nucleotide


Download         Length: 396 bp        

>NTDB_id=1034673 AB6911_RS13405 WP_309484978.1 2623887..2624282(-) (comGF) [Bacillus atrophaeus strain globigii]
CTGTCAGTTTATCTGCTCATATCAGGCTCTTTAGCCATGATCTTTTATCAGTTTTTATCCCGTCAACTGGAGGGGGAGGG
GGTCAAGCAGGAGGAATGGATCATTTCCGTTGAGCAAATGATGAATGAATGTAAGCAGGCTGAGAGTGTGCAGCTGACTG
ATAAGGGCGGCGGTGTGCTGTGCAGGAATGGTTCAGGCCGAGAGATTCTTTTTGAAAAATATCATAAAATGATCAGGAAA
AGAGTGGACGGTAAAGGGCATGTCCCGATTCTTCAGCATATTAACACATTGAAAGCTGATATAAAAAACGGCATGCTGAT
CTTGAGCGTAACAAGTGAAGACCATAAAGAGTACAAAACCTCTTTTCCTATTTATACATCATTGAAAGGAGGATAA

Domains

Predicted by InterproScan.

Putative Competence protein ComGF (ComGF)

(22-118)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

58.268

96.947

0.565

Multiple sequence alignment