Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   AB6911_RS13365 Genome accession   NZ_CP166481
Coordinates   2619794..2619967 (+) Length   57 a.a.
NCBI ID   WP_003325442.1    Uniprot ID   -
Organism   Bacillus atrophaeus strain globigii     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2614794..2624967
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB6911_RS13350 (AB6911_13330) gcvT 2615563..2616657 (-) 1095 WP_003325445.1 glycine cleavage system aminomethyltransferase GcvT -
  AB6911_RS13355 (AB6911_13335) - 2617118..2618788 (+) 1671 WP_003325444.1 DEAD/DEAH box helicase -
  AB6911_RS13360 (AB6911_13340) - 2618809..2619603 (+) 795 WP_003325443.1 YqhG family protein -
  AB6911_RS13365 (AB6911_13345) sinI 2619794..2619967 (+) 174 WP_003325442.1 anti-repressor SinI Regulator
  AB6911_RS13370 (AB6911_13350) sinR 2620001..2620336 (+) 336 WP_003325441.1 transcriptional regulator SinR Regulator
  AB6911_RS13375 (AB6911_13355) tasA 2620528..2621310 (-) 783 WP_003325439.1 biofilm matrix protein TasA -
  AB6911_RS13380 (AB6911_13360) sipW 2621374..2621946 (-) 573 WP_010789195.1 signal peptidase I SipW -
  AB6911_RS13385 (AB6911_13365) tapA 2621930..2622631 (-) 702 WP_003325437.1 amyloid fiber anchoring/assembly protein TapA -
  AB6911_RS13390 (AB6911_13370) - 2622893..2623216 (+) 324 WP_003325436.1 DUF3889 domain-containing protein -
  AB6911_RS13395 (AB6911_13375) - 2623263..2623442 (-) 180 WP_003325435.1 YqzE family protein -
  AB6911_RS13400 (AB6911_13380) comGG 2623512..2623886 (-) 375 WP_003325434.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB6911_RS13405 (AB6911_13385) comGF 2623887..2624282 (-) 396 WP_309484978.1 competence type IV pilus minor pilin ComGF Machinery gene
  AB6911_RS13410 (AB6911_13390) comGE 2624296..2624643 (-) 348 WP_003325432.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6813.90 Da        Isoelectric Point: 10.0469

>NTDB_id=1034670 AB6911_RS13365 WP_003325442.1 2619794..2619967(+) (sinI) [Bacillus atrophaeus strain globigii]
MKNAKKELLELDQEWVELMKRAREANINPEEIRKYLYLHKKSAHPVPATRSHTINPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1034670 AB6911_RS13365 WP_003325442.1 2619794..2619967(+) (sinI) [Bacillus atrophaeus strain globigii]
ATGAAAAATGCAAAAAAAGAGCTTTTAGAATTAGATCAAGAATGGGTTGAATTAATGAAAAGAGCCAGAGAAGCAAATAT
CAACCCGGAGGAGATACGCAAATATTTATATTTGCATAAAAAGTCTGCTCATCCTGTCCCAGCCACCAGAAGTCATACCA
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

78.947

100

0.789

Multiple sequence alignment