Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   AB8O67_RS13570 Genome accession   NZ_CP166053
Coordinates   2582479..2582862 (-) Length   127 a.a.
NCBI ID   WP_157722684.1    Uniprot ID   -
Organism   Bacillus halotolerans strain XYK2-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2577479..2587862
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB8O67_RS13530 (AB8O67_13535) sinI 2578413..2578586 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  AB8O67_RS13535 (AB8O67_13540) sinR 2578620..2578955 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB8O67_RS13540 (AB8O67_13545) tasA 2579042..2579827 (-) 786 WP_059293609.1 biofilm matrix protein TasA -
  AB8O67_RS13545 (AB8O67_13550) sipW 2579892..2580476 (-) 585 WP_059293608.1 signal peptidase I SipW -
  AB8O67_RS13550 (AB8O67_13555) tapA 2580448..2581209 (-) 762 WP_369888225.1 amyloid fiber anchoring/assembly protein TapA -
  AB8O67_RS13555 (AB8O67_13560) - 2581486..2581809 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  AB8O67_RS13560 (AB8O67_13565) - 2581852..2582031 (-) 180 WP_003236949.1 YqzE family protein -
  AB8O67_RS13565 (AB8O67_13570) comGG 2582103..2582478 (-) 376 Protein_2625 competence type IV pilus minor pilin ComGG -
  AB8O67_RS13570 (AB8O67_13575) comGF 2582479..2582862 (-) 384 WP_157722684.1 competence type IV pilus minor pilin ComGF Machinery gene
  AB8O67_RS13575 (AB8O67_13580) comGE 2582888..2583235 (-) 348 WP_369888226.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB8O67_RS13580 (AB8O67_13585) comGD 2583219..2583650 (-) 432 WP_044154579.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB8O67_RS13585 (AB8O67_13590) comGC 2583640..2583936 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  AB8O67_RS13590 (AB8O67_13595) comGB 2583950..2584987 (-) 1038 WP_369888227.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB8O67_RS13595 (AB8O67_13600) comGA 2584974..2586044 (-) 1071 WP_326139066.1 competence protein ComGA Machinery gene
  AB8O67_RS13600 (AB8O67_13605) - 2586367..2586777 (-) 411 WP_106293703.1 CBS domain-containing protein -
  AB8O67_RS13605 (AB8O67_13610) corA 2586840..2587793 (-) 954 WP_059335416.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14707.92 Da        Isoelectric Point: 7.3829

>NTDB_id=1033202 AB8O67_RS13570 WP_157722684.1 2582479..2582862(-) (comGF) [Bacillus halotolerans strain XYK2-4]
MLISGSLAMYFHLFLSRQQENEGFMQREWIISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFEIYHSMIRKRVDG
KGHVPILDHIKTMKAEVKNGMLWLKVKNENDKEYQTAFPVYTSLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=1033202 AB8O67_RS13570 WP_157722684.1 2582479..2582862(-) (comGF) [Bacillus halotolerans strain XYK2-4]
TTGCTCATATCAGGATCGTTAGCGATGTACTTTCATCTATTTTTGTCACGTCAACAGGAGAATGAGGGCTTCATGCAGCG
GGAATGGATCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGCAATCGCAGACAGTGCAGACAGATGAGCATGGGAGCG
TCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAAATCTACCATTCAATGATCAGGAAAAGAGTAGACGGA
AAAGGGCATGTTCCGATTCTTGACCATATTAAAACAATGAAAGCCGAGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAA
GAATGAGAATGATAAAGAGTATCAAACAGCTTTTCCGGTATATACGTCGTTAGGAGGTGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

73.228

100

0.732


Multiple sequence alignment