Detailed information NTG1031736

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB7T04_RS11590
• Genome accession: NZ_CP165780
• Coordinates: 2401004..2401441 (-)
• Length: 145 a.a.
• NCBI ID: WP_025852922.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain L-15
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2396004..2406441

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB7T04_RS11540 (AB7T04_11540)	sinI	2396389..2396562 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB7T04_RS11545 (AB7T04_11545)	sinR	2396596..2396931 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB7T04_RS11550 (AB7T04_11550)	tasA	2396979..2397764 (-)	786	WP_369719084.1	biofilm matrix protein TasA	-
AB7T04_RS11555 (AB7T04_11555)	sipW	2397828..2398412 (-)	585	WP_060562614.1	signal peptidase I SipW	-
AB7T04_RS11560 (AB7T04_11560)	tapA	2398384..2399055 (-)	672	WP_071391613.1	amyloid fiber anchoring/assembly protein TapA	-
AB7T04_RS11565 (AB7T04_11565)	-	2399314..2399643 (+)	330	WP_071391612.1	DUF3889 domain-containing protein	-
AB7T04_RS11570 (AB7T04_11570)	-	2399683..2399862 (-)	180	WP_003153093.1	YqzE family protein	-
AB7T04_RS11575 (AB7T04_11575)	comGG	2399919..2400296 (-)	378	WP_071391611.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB7T04_RS11580 (AB7T04_11580)	comGF	2400297..2400797 (-)	501	WP_230014462.1	competence type IV pilus minor pilin ComGF	-
AB7T04_RS11585 (AB7T04_11585)	comGE	2400706..2401020 (-)	315	WP_015388003.1	competence type IV pilus minor pilin ComGE	Machinery gene
AB7T04_RS11590 (AB7T04_11590)	comGD	2401004..2401441 (-)	438	WP_025852922.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB7T04_RS11595 (AB7T04_11595)	comGC	2401431..2401739 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB7T04_RS11600 (AB7T04_11600)	comGB	2401744..2402781 (-)	1038	WP_063174751.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB7T04_RS11605 (AB7T04_11605)	comGA	2402768..2403838 (-)	1071	WP_003153083.1	competence type IV pilus ATPase ComGA	Machinery gene
AB7T04_RS11610 (AB7T04_11610)	-	2404030..2404980 (-)	951	WP_071391609.1	magnesium transporter CorA family protein	-
AB7T04_RS11615 (AB7T04_11615)	-	2405127..2406428 (+)	1302	WP_166706141.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16268.78 Da
• Isoelectric Point: 10.1850

>NTDB_id=1031736 AB7T04_RS11590 WP_025852922.1 2401004..2401441(-) (comGD) [Bacillus velezensis strain L-15]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1031736 AB7T04_RS11590 WP_025852922.1 2401004..2401441(-) (comGD) [Bacillus velezensis strain L-15]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGCCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTAACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	54.795	100	0.552