Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   AB7T04_RS11585 Genome accession   NZ_CP165780
Coordinates   2400706..2401020 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain L-15     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2395706..2406020
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB7T04_RS11540 (AB7T04_11540) sinI 2396389..2396562 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB7T04_RS11545 (AB7T04_11545) sinR 2396596..2396931 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB7T04_RS11550 (AB7T04_11550) tasA 2396979..2397764 (-) 786 WP_369719084.1 biofilm matrix protein TasA -
  AB7T04_RS11555 (AB7T04_11555) sipW 2397828..2398412 (-) 585 WP_060562614.1 signal peptidase I SipW -
  AB7T04_RS11560 (AB7T04_11560) tapA 2398384..2399055 (-) 672 WP_071391613.1 amyloid fiber anchoring/assembly protein TapA -
  AB7T04_RS11565 (AB7T04_11565) - 2399314..2399643 (+) 330 WP_071391612.1 DUF3889 domain-containing protein -
  AB7T04_RS11570 (AB7T04_11570) - 2399683..2399862 (-) 180 WP_003153093.1 YqzE family protein -
  AB7T04_RS11575 (AB7T04_11575) comGG 2399919..2400296 (-) 378 WP_071391611.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB7T04_RS11580 (AB7T04_11580) comGF 2400297..2400797 (-) 501 WP_230014462.1 competence type IV pilus minor pilin ComGF -
  AB7T04_RS11585 (AB7T04_11585) comGE 2400706..2401020 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  AB7T04_RS11590 (AB7T04_11590) comGD 2401004..2401441 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB7T04_RS11595 (AB7T04_11595) comGC 2401431..2401739 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB7T04_RS11600 (AB7T04_11600) comGB 2401744..2402781 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB7T04_RS11605 (AB7T04_11605) comGA 2402768..2403838 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  AB7T04_RS11610 (AB7T04_11610) - 2404030..2404980 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=1031735 AB7T04_RS11585 WP_015388003.1 2400706..2401020(-) (comGE) [Bacillus velezensis strain L-15]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=1031735 AB7T04_RS11585 WP_015388003.1 2400706..2401020(-) (comGE) [Bacillus velezensis strain L-15]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481

Multiple sequence alignment