Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB7T04_RS11540 | Genome accession | NZ_CP165780 |
| Coordinates | 2396389..2396562 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain L-15 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2391389..2401562
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB7T04_RS11525 (AB7T04_11525) | gcvT | 2392206..2393306 (-) | 1101 | WP_071391617.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB7T04_RS11530 (AB7T04_11530) | - | 2393730..2395400 (+) | 1671 | WP_046559872.1 | DEAD/DEAH box helicase | - |
| AB7T04_RS11535 (AB7T04_11535) | - | 2395418..2396212 (+) | 795 | WP_071391615.1 | YqhG family protein | - |
| AB7T04_RS11540 (AB7T04_11540) | sinI | 2396389..2396562 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB7T04_RS11545 (AB7T04_11545) | sinR | 2396596..2396931 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB7T04_RS11550 (AB7T04_11550) | tasA | 2396979..2397764 (-) | 786 | WP_369719084.1 | biofilm matrix protein TasA | - |
| AB7T04_RS11555 (AB7T04_11555) | sipW | 2397828..2398412 (-) | 585 | WP_060562614.1 | signal peptidase I SipW | - |
| AB7T04_RS11560 (AB7T04_11560) | tapA | 2398384..2399055 (-) | 672 | WP_071391613.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB7T04_RS11565 (AB7T04_11565) | - | 2399314..2399643 (+) | 330 | WP_071391612.1 | DUF3889 domain-containing protein | - |
| AB7T04_RS11570 (AB7T04_11570) | - | 2399683..2399862 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB7T04_RS11575 (AB7T04_11575) | comGG | 2399919..2400296 (-) | 378 | WP_071391611.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB7T04_RS11580 (AB7T04_11580) | comGF | 2400297..2400797 (-) | 501 | WP_230014462.1 | competence type IV pilus minor pilin ComGF | - |
| AB7T04_RS11585 (AB7T04_11585) | comGE | 2400706..2401020 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| AB7T04_RS11590 (AB7T04_11590) | comGD | 2401004..2401441 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1031732 AB7T04_RS11540 WP_003153105.1 2396389..2396562(+) (sinI) [Bacillus velezensis strain L-15]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1031732 AB7T04_RS11540 WP_003153105.1 2396389..2396562(+) (sinI) [Bacillus velezensis strain L-15]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |