Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   SL318_RS01865 Genome accession   NZ_CP165630
Coordinates   414620..415090 (+) Length   156 a.a.
NCBI ID   WP_000934759.1    Uniprot ID   A0A2I7Y8V1
Organism   Staphylococcus aureus strain BSN54     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 404824..445084 414620..415090 within 0


Gene organization within MGE regions


Location: 404824..445084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SL318_RS01785 (SL318_01785) - 404824..406029 (-) 1206 WP_000264186.1 tyrosine-type recombinase/integrase -
  SL318_RS01790 (SL318_01790) - 406238..406918 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  SL318_RS01795 (SL318_01795) - 406950..407588 (-) 639 WP_000874708.1 S24 family peptidase -
  SL318_RS01800 (SL318_01800) - 407778..408032 (+) 255 WP_001106626.1 helix-turn-helix domain-containing protein -
  SL318_RS01805 (SL318_01805) - 408047..408208 (+) 162 WP_001153176.1 hypothetical protein -
  SL318_RS01810 (SL318_01810) - 408169..408339 (-) 171 WP_001280594.1 hypothetical protein -
  SL318_RS01815 (SL318_01815) - 408781..408966 (+) 186 WP_000933364.1 helix-turn-helix domain-containing protein -
  SL318_RS01820 (SL318_01820) - 408968..409711 (+) 744 WP_001148623.1 phage antirepressor KilAC domain-containing protein -
  SL318_RS01825 (SL318_01825) - 409736..409835 (+) 100 Protein_362 hypothetical protein -
  SL318_RS01830 (SL318_01830) - 409984..410247 (+) 264 WP_001124198.1 helix-turn-helix domain-containing protein -
  SL318_RS01835 (SL318_01835) - 410259..410420 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  SL318_RS01840 (SL318_01840) - 410515..410775 (+) 261 WP_000291488.1 DUF1108 family protein -
  SL318_RS01845 (SL318_01845) - 410784..411047 (+) 264 WP_001205732.1 hypothetical protein -
  SL318_RS01850 (SL318_01850) - 411044..412999 (+) 1956 WP_320237218.1 AAA family ATPase -
  SL318_RS01855 (SL318_01855) - 413001..413921 (+) 921 WP_000138481.1 recombinase RecT -
  SL318_RS01860 (SL318_01860) - 414002..414619 (+) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  SL318_RS01865 (SL318_01865) ssbA 414620..415090 (+) 471 WP_000934759.1 single-stranded DNA-binding protein Machinery gene
  SL318_RS01870 (SL318_01870) - 415120..416013 (+) 894 WP_000148333.1 DnaD domain-containing protein -
  SL318_RS01875 (SL318_01875) - 416020..416238 (+) 219 WP_000338528.1 hypothetical protein -
  SL318_RS01880 (SL318_01880) - 416247..416651 (+) 405 WP_000401969.1 RusA family crossover junction endodeoxyribonuclease -
  SL318_RS01885 (SL318_01885) - 416664..417035 (+) 372 WP_374936582.1 SA1788 family PVL leukocidin-associated protein -
  SL318_RS01890 (SL318_01890) - 417036..417284 (+) 249 WP_001614809.1 SAV1978 family virulence-associated passenger protein -
  SL318_RS01895 (SL318_01895) - 417299..417697 (+) 399 Protein_376 hypothetical protein -
  SL318_RS01900 (SL318_01900) - 417698..417892 (+) 195 Protein_377 hypothetical protein -
  SL318_RS01905 (SL318_01905) - 417885..418139 (+) 255 WP_001065104.1 DUF1024 family protein -
  SL318_RS01910 (SL318_01910) - 418126..418296 (+) 171 WP_000714407.1 hypothetical protein -
  SL318_RS01915 (SL318_01915) - 418289..418825 (+) 537 WP_001066454.1 dUTPase -
  SL318_RS01920 (SL318_01920) - 418862..419107 (+) 246 WP_374936583.1 hypothetical protein -
  SL318_RS01925 (SL318_01925) - 419104..419310 (+) 207 WP_374936584.1 DUF1381 domain-containing protein -
  SL318_RS01930 (SL318_01930) rinB 419307..419480 (+) 174 WP_000595256.1 transcriptional activator RinB -
  SL318_RS01935 (SL318_01935) - 419481..419882 (+) 402 WP_000286968.1 hypothetical protein -
  SL318_RS01940 (SL318_01940) - 420237..420731 (+) 495 WP_320237221.1 terminase small subunit -
  SL318_RS01945 (SL318_01945) - 420724..421932 (+) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  SL318_RS01950 (SL318_01950) - 421946..423364 (+) 1419 WP_000283553.1 phage portal protein -
  SL318_RS01955 (SL318_01955) - 423303..424283 (+) 981 WP_001795666.1 phage head morphogenesis protein -
  SL318_RS01960 (SL318_01960) - 424381..424977 (+) 597 WP_000366932.1 phage scaffolding protein -
  SL318_RS01965 (SL318_01965) - 424998..425822 (+) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  SL318_RS01970 (SL318_01970) - 425839..426165 (+) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  SL318_RS01975 (SL318_01975) - 426165..426479 (+) 315 WP_000338935.1 phage head-tail connector protein -
  SL318_RS01980 (SL318_01980) - 426472..426807 (+) 336 WP_000482986.1 phage head closure protein -
  SL318_RS01985 (SL318_01985) - 426794..427207 (+) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  SL318_RS01990 (SL318_01990) - 427220..427657 (+) 438 WP_000270196.1 DUF3168 domain-containing protein -
  SL318_RS01995 (SL318_01995) - 427644..428204 (+) 561 WP_000046067.1 hypothetical protein -
  SL318_RS02000 (SL318_02000) - 428265..428759 (+) 495 WP_000141082.1 tail assembly chaperone -
  SL318_RS02005 (SL318_02005) - 428780..429121 (+) 342 WP_001580347.1 hypothetical protein -
  SL318_RS02010 (SL318_02010) - 429124..432093 (+) 2970 WP_320237222.1 terminase -
  SL318_RS02015 (SL318_02015) - 432108..433043 (+) 936 WP_000560196.1 phage tail domain-containing protein -
  SL318_RS02020 (SL318_02020) - 433054..434940 (+) 1887 WP_031786321.1 SGNH/GDSL hydrolase family protein -
  SL318_RS02025 (SL318_02025) - 434953..436851 (+) 1899 WP_031864634.1 hypothetical protein -
  SL318_RS02030 (SL318_02030) - 436851..438674 (+) 1824 WP_031862517.1 phage baseplate upper protein -
  SL318_RS02035 (SL318_02035) - 438674..439051 (+) 378 WP_000705909.1 DUF2977 domain-containing protein -
  SL318_RS02040 (SL318_02040) - 439055..439228 (+) 174 WP_001790193.1 XkdX family protein -
  SL318_RS02045 (SL318_02045) - 439269..439568 (+) 300 WP_000466769.1 DUF2951 domain-containing protein -
  SL318_RS02050 (SL318_02050) - 439705..441579 (+) 1875 WP_016187665.1 glucosaminidase domain-containing protein -
  SL318_RS02055 (SL318_02055) - 441592..442764 (+) 1173 WP_000276627.1 BppU family phage baseplate upper protein -
  SL318_RS02060 (SL318_02060) - 442770..443165 (+) 396 WP_000398878.1 hypothetical protein -
  SL318_RS02065 (SL318_02065) - 443221..443658 (+) 438 WP_374936585.1 phage holin -
  SL318_RS02070 (SL318_02070) - 443639..445084 (+) 1446 WP_001148125.1 SH3 domain-containing protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17641.52 Da        Isoelectric Point: 5.2672

>NTDB_id=1030997 SL318_RS01865 WP_000934759.1 414620..415090(+) (ssbA) [Staphylococcus aureus strain BSN54]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1030997 SL318_RS01865 WP_000934759.1 414620..415090(+) (ssbA) [Staphylococcus aureus strain BSN54]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2I7Y8V1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.932

100

0.635

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment