Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   AB5991_RS12770 Genome accession   NZ_CP163447
Coordinates   2375025..2375399 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain SD2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2370025..2380399
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB5991_RS12730 (AB5991_12730) yqhG 2370357..2371151 (+) 795 WP_014480249.1 YqhG family protein -
  AB5991_RS12735 (AB5991_12735) sinI 2371334..2371507 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB5991_RS12740 (AB5991_12740) sinR 2371541..2371876 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB5991_RS12745 (AB5991_12745) tasA 2371969..2372754 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  AB5991_RS12750 (AB5991_12750) sipW 2372818..2373390 (-) 573 WP_003230181.1 signal peptidase I SipW -
  AB5991_RS12755 (AB5991_12755) tapA 2373374..2374135 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AB5991_RS12760 (AB5991_12760) yqzG 2374407..2374733 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB5991_RS12765 (AB5991_12765) spoIITA 2374775..2374954 (-) 180 WP_014480252.1 YqzE family protein -
  AB5991_RS12770 (AB5991_12770) comGG 2375025..2375399 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AB5991_RS12775 (AB5991_12775) comGF 2375400..2375783 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  AB5991_RS12780 (AB5991_12780) comGE 2375809..2376156 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  AB5991_RS12785 (AB5991_12785) comGD 2376140..2376571 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  AB5991_RS12790 (AB5991_12790) comGC 2376561..2376857 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  AB5991_RS12795 (AB5991_12795) comGB 2376871..2377908 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  AB5991_RS12800 (AB5991_12800) comGA 2377895..2378965 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  AB5991_RS12805 (AB5991_12805) - 2379177..2379374 (-) 198 WP_014480259.1 CBS domain-containing protein -
  AB5991_RS12810 (AB5991_12810) corA 2379376..2380329 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=1029857 AB5991_RS12770 WP_014480253.1 2375025..2375399(-) (comGG) [Bacillus subtilis strain SD2]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=1029857 AB5991_RS12770 WP_014480253.1 2375025..2375399(-) (comGG) [Bacillus subtilis strain SD2]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment