Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB5991_RS12735 Genome accession   NZ_CP163447
Coordinates   2371334..2371507 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SD2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2366334..2376507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB5991_RS12720 (AB5991_12720) gcvT 2367133..2368221 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  AB5991_RS12725 (AB5991_12725) hepAA 2368663..2370336 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  AB5991_RS12730 (AB5991_12730) yqhG 2370357..2371151 (+) 795 WP_014480249.1 YqhG family protein -
  AB5991_RS12735 (AB5991_12735) sinI 2371334..2371507 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  AB5991_RS12740 (AB5991_12740) sinR 2371541..2371876 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  AB5991_RS12745 (AB5991_12745) tasA 2371969..2372754 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  AB5991_RS12750 (AB5991_12750) sipW 2372818..2373390 (-) 573 WP_003230181.1 signal peptidase I SipW -
  AB5991_RS12755 (AB5991_12755) tapA 2373374..2374135 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  AB5991_RS12760 (AB5991_12760) yqzG 2374407..2374733 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  AB5991_RS12765 (AB5991_12765) spoIITA 2374775..2374954 (-) 180 WP_014480252.1 YqzE family protein -
  AB5991_RS12770 (AB5991_12770) comGG 2375025..2375399 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  AB5991_RS12775 (AB5991_12775) comGF 2375400..2375783 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  AB5991_RS12780 (AB5991_12780) comGE 2375809..2376156 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=1029855 AB5991_RS12735 WP_003230187.1 2371334..2371507(+) (sinI) [Bacillus subtilis strain SD2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1029855 AB5991_RS12735 WP_003230187.1 2371334..2371507(+) (sinI) [Bacillus subtilis strain SD2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment