Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AB3431_RS07690 | Genome accession | NZ_CP162467 |
| Coordinates | 1529845..1530348 (+) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain TUM20823 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1525782..1571507 | 1529845..1530348 | within | 0 |
Gene organization within MGE regions
Location: 1525782..1571507
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3431_RS07660 (AB3431_07660) | - | 1525782..1526627 (+) | 846 | WP_001550052.1 | ParB/RepB/Spo0J family partition protein | - |
| AB3431_RS07665 (AB3431_07665) | - | 1526784..1527665 (+) | 882 | WP_001077602.1 | mechanosensitive ion channel family protein | - |
| AB3431_RS07670 (AB3431_07670) | - | 1527695..1527898 (+) | 204 | WP_000157345.1 | DUF951 domain-containing protein | - |
| AB3431_RS07675 (AB3431_07675) | ychF | 1527910..1529007 (+) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| AB3431_RS07680 (AB3431_07680) | - | 1529093..1529284 (-) | 192 | WP_001052483.1 | hypothetical protein | - |
| AB3431_RS07685 (AB3431_07685) | rpsF | 1529528..1529824 (+) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| AB3431_RS07690 (AB3431_07690) | ssbA | 1529845..1530348 (+) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| AB3431_RS07695 (AB3431_07695) | rpsR | 1530400..1530642 (+) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| AB3431_RS07700 (AB3431_07700) | - | 1530824..1531654 (-) | 831 | WP_000357934.1 | KilA-N domain-containing protein | - |
| AB3431_RS07705 (AB3431_07705) | - | 1532137..1533354 (-) | 1218 | WP_000270130.1 | site-specific integrase | - |
| AB3431_RS07710 (AB3431_07710) | - | 1533810..1534505 (-) | 696 | WP_000668212.1 | helix-turn-helix domain-containing protein | - |
| AB3431_RS07715 (AB3431_07715) | - | 1534649..1534861 (+) | 213 | WP_000794656.1 | helix-turn-helix transcriptional regulator | - |
| AB3431_RS07720 (AB3431_07720) | - | 1534862..1535134 (+) | 273 | WP_000091734.1 | helix-turn-helix domain-containing protein | - |
| AB3431_RS07725 (AB3431_07725) | - | 1535146..1535292 (+) | 147 | WP_031824147.1 | hypothetical protein | - |
| AB3431_RS07730 (AB3431_07730) | - | 1535285..1535494 (+) | 210 | WP_001058486.1 | type II toxin-antitoxin system antitoxin TscA | - |
| AB3431_RS07735 (AB3431_07735) | - | 1535497..1535814 (+) | 318 | WP_001103936.1 | type II toxin-antitoxin system toxin TscT | - |
| AB3431_RS07740 (AB3431_07740) | - | 1535878..1536747 (+) | 870 | WP_001002700.1 | primase alpha helix C-terminal domain-containing protein | - |
| AB3431_RS07745 (AB3431_07745) | - | 1536764..1538233 (+) | 1470 | WP_001795628.1 | virulence-associated E family protein | - |
| AB3431_RS07750 (AB3431_07750) | - | 1538519..1538881 (+) | 363 | WP_108932420.1 | pathogenicity island protein | - |
| AB3431_RS07755 (AB3431_07755) | - | 1538883..1539167 (+) | 285 | WP_000998182.1 | hypothetical protein | - |
| AB3431_RS07760 (AB3431_07760) | - | 1539164..1539805 (+) | 642 | WP_001019769.1 | hypothetical protein | - |
| AB3431_RS07765 (AB3431_07765) | - | 1540152..1540493 (+) | 342 | WP_001161659.1 | hypothetical protein | - |
| AB3431_RS07770 (AB3431_07770) | - | 1540505..1541083 (+) | 579 | WP_000846292.1 | hypothetical protein | - |
| AB3431_RS07775 (AB3431_07775) | - | 1541101..1541319 (+) | 219 | WP_000448775.1 | capsid morphogenesis B protein | - |
| AB3431_RS07780 (AB3431_07780) | - | 1541370..1541897 (+) | 528 | WP_000771356.1 | spore coat protein | - |
| AB3431_RS07785 (AB3431_07785) | - | 1541900..1542241 (+) | 342 | WP_000358778.1 | hypothetical protein | - |
| AB3431_RS07790 (AB3431_07790) | - | 1542238..1542807 (+) | 570 | WP_001293080.1 | terminase small subunit | - |
| AB3431_RS07795 (AB3431_07795) | - | 1542854..1542937 (+) | 84 | Protein_1503 | terminase small subunit | - |
| AB3431_RS07800 (AB3431_07800) | - | 1543084..1544052 (+) | 969 | WP_000801979.1 | Abi family protein | - |
| AB3431_RS07805 (AB3431_07805) | - | 1544536..1544657 (+) | 122 | Protein_1505 | hypothetical protein | - |
| AB3431_RS07810 (AB3431_07810) | - | 1544900..1545052 (+) | 153 | WP_001795626.1 | hypothetical protein | - |
| AB3431_RS07815 (AB3431_07815) | - | 1545123..1545233 (+) | 111 | WP_000139423.1 | hypothetical protein | - |
| AB3431_RS07820 (AB3431_07820) | - | 1545235..1545420 (+) | 186 | WP_001286805.1 | hypothetical protein | - |
| AB3431_RS07825 (AB3431_07825) | - | 1546559..1547497 (-) | 939 | WP_001822249.1 | Abi family protein | - |
| AB3431_RS07830 (AB3431_07830) | - | 1547536..1548243 (-) | 708 | Protein_1510 | tyrosine-type recombinase/integrase | - |
| AB3431_RS07835 (AB3431_07835) | selX | 1548443..1549054 (+) | 612 | WP_000475326.1 | staphylococcal enterotoxin-like toxin X | - |
| AB3431_RS07840 (AB3431_07840) | - | 1549423..1549791 (+) | 369 | WP_108932421.1 | YxeA family protein | - |
| AB3431_RS07845 (AB3431_07845) | - | 1549972..1550544 (+) | 573 | WP_000769720.1 | PepSY domain-containing protein | - |
| AB3431_RS07850 (AB3431_07850) | - | 1550682..1550945 (-) | 264 | WP_001055897.1 | helix-turn-helix transcriptional regulator | - |
| AB3431_RS07855 (AB3431_07855) | - | 1551245..1551496 (+) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| AB3431_RS07860 (AB3431_07860) | - | 1551535..1551744 (-) | 210 | WP_000211676.1 | hypothetical protein | - |
| AB3431_RS07865 (AB3431_07865) | - | 1551922..1552503 (+) | 582 | WP_000158374.1 | histidine phosphatase family protein | - |
| AB3431_RS07870 (AB3431_07870) | - | 1552569..1552952 (-) | 384 | WP_000868248.1 | hypothetical protein | - |
| AB3431_RS07875 (AB3431_07875) | - | 1553207..1553833 (-) | 627 | WP_000746687.1 | NDxxF motif lipoprotein | - |
| AB3431_RS07880 (AB3431_07880) | - | 1553906..1554148 (-) | 243 | Protein_1520 | hypothetical protein | - |
| AB3431_RS07885 (AB3431_07885) | ahpF | 1554278..1555801 (-) | 1524 | WP_000930486.1 | alkyl hydroperoxide reductase subunit F | - |
| AB3431_RS07890 (AB3431_07890) | ahpC | 1555817..1556386 (-) | 570 | WP_000052781.1 | alkyl hydroperoxide reductase subunit C | - |
| AB3431_RS07895 (AB3431_07895) | nfsA | 1556878..1557633 (+) | 756 | WP_001289311.1 | oxygen-insensitive NADPH nitroreductase | - |
| AB3431_RS07900 (AB3431_07900) | - | 1557714..1559102 (-) | 1389 | WP_000991007.1 | L-cystine transporter | - |
| AB3431_RS07905 (AB3431_07905) | - | 1559187..1559288 (+) | 102 | WP_001789518.1 | hypothetical protein | - |
| AB3431_RS07910 (AB3431_07910) | - | 1560079..1561035 (-) | 957 | WP_000956132.1 | hypothetical protein | - |
| AB3431_RS07915 (AB3431_07915) | - | 1561153..1561815 (-) | 663 | WP_000394698.1 | hypothetical protein | - |
| AB3431_RS07920 (AB3431_07920) | - | 1561958..1562365 (-) | 408 | WP_000763768.1 | general stress protein | - |
| AB3431_RS07925 (AB3431_07925) | xpt | 1562878..1563456 (+) | 579 | WP_000421410.1 | xanthine phosphoribosyltransferase | - |
| AB3431_RS07930 (AB3431_07930) | pbuX | 1563456..1564724 (+) | 1269 | WP_000793011.1 | xanthine permease PbuX | - |
| AB3431_RS07935 (AB3431_07935) | guaB | 1564762..1566228 (+) | 1467 | WP_000264071.1 | IMP dehydrogenase | - |
| AB3431_RS07940 (AB3431_07940) | guaA | 1566253..1567794 (+) | 1542 | WP_000424966.1 | glutamine-hydrolyzing GMP synthase | - |
| AB3431_RS07945 (AB3431_07945) | - | 1567907..1568443 (-) | 537 | WP_000551776.1 | hypothetical protein | - |
| AB3431_RS07950 (AB3431_07950) | - | 1568836..1569540 (-) | 705 | WP_000041883.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AB3431_RS07955 (AB3431_07955) | - | 1569939..1570211 (-) | 273 | WP_000159787.1 | transposase | - |
| AB3431_RS07960 (AB3431_07960) | - | 1570472..1570624 (-) | 153 | WP_000248839.1 | hypothetical protein | - |
| AB3431_RS07965 (AB3431_07965) | - | 1571148..1571507 (-) | 360 | WP_001021618.1 | DUF1304 domain-containing protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=1026164 AB3431_RS07690 WP_000934799.1 1529845..1530348(+) (ssbA) [Staphylococcus aureus strain TUM20823]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=1026164 AB3431_RS07690 WP_000934799.1 1529845..1530348(+) (ssbA) [Staphylococcus aureus strain TUM20823]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |