Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AB3431_RS07690 Genome accession   NZ_CP162467
Coordinates   1529845..1530348 (+) Length   167 a.a.
NCBI ID   WP_000934799.1    Uniprot ID   A0A7U7IE99
Organism   Staphylococcus aureus strain TUM20823     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1525782..1571507 1529845..1530348 within 0


Gene organization within MGE regions


Location: 1525782..1571507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3431_RS07660 (AB3431_07660) - 1525782..1526627 (+) 846 WP_001550052.1 ParB/RepB/Spo0J family partition protein -
  AB3431_RS07665 (AB3431_07665) - 1526784..1527665 (+) 882 WP_001077602.1 mechanosensitive ion channel family protein -
  AB3431_RS07670 (AB3431_07670) - 1527695..1527898 (+) 204 WP_000157345.1 DUF951 domain-containing protein -
  AB3431_RS07675 (AB3431_07675) ychF 1527910..1529007 (+) 1098 WP_001218732.1 redox-regulated ATPase YchF -
  AB3431_RS07680 (AB3431_07680) - 1529093..1529284 (-) 192 WP_001052483.1 hypothetical protein -
  AB3431_RS07685 (AB3431_07685) rpsF 1529528..1529824 (+) 297 WP_001261460.1 30S ribosomal protein S6 -
  AB3431_RS07690 (AB3431_07690) ssbA 1529845..1530348 (+) 504 WP_000934799.1 single-stranded DNA-binding protein Machinery gene
  AB3431_RS07695 (AB3431_07695) rpsR 1530400..1530642 (+) 243 WP_000897044.1 30S ribosomal protein S18 -
  AB3431_RS07700 (AB3431_07700) - 1530824..1531654 (-) 831 WP_000357934.1 KilA-N domain-containing protein -
  AB3431_RS07705 (AB3431_07705) - 1532137..1533354 (-) 1218 WP_000270130.1 site-specific integrase -
  AB3431_RS07710 (AB3431_07710) - 1533810..1534505 (-) 696 WP_000668212.1 helix-turn-helix domain-containing protein -
  AB3431_RS07715 (AB3431_07715) - 1534649..1534861 (+) 213 WP_000794656.1 helix-turn-helix transcriptional regulator -
  AB3431_RS07720 (AB3431_07720) - 1534862..1535134 (+) 273 WP_000091734.1 helix-turn-helix domain-containing protein -
  AB3431_RS07725 (AB3431_07725) - 1535146..1535292 (+) 147 WP_031824147.1 hypothetical protein -
  AB3431_RS07730 (AB3431_07730) - 1535285..1535494 (+) 210 WP_001058486.1 type II toxin-antitoxin system antitoxin TscA -
  AB3431_RS07735 (AB3431_07735) - 1535497..1535814 (+) 318 WP_001103936.1 type II toxin-antitoxin system toxin TscT -
  AB3431_RS07740 (AB3431_07740) - 1535878..1536747 (+) 870 WP_001002700.1 primase alpha helix C-terminal domain-containing protein -
  AB3431_RS07745 (AB3431_07745) - 1536764..1538233 (+) 1470 WP_001795628.1 virulence-associated E family protein -
  AB3431_RS07750 (AB3431_07750) - 1538519..1538881 (+) 363 WP_108932420.1 pathogenicity island protein -
  AB3431_RS07755 (AB3431_07755) - 1538883..1539167 (+) 285 WP_000998182.1 hypothetical protein -
  AB3431_RS07760 (AB3431_07760) - 1539164..1539805 (+) 642 WP_001019769.1 hypothetical protein -
  AB3431_RS07765 (AB3431_07765) - 1540152..1540493 (+) 342 WP_001161659.1 hypothetical protein -
  AB3431_RS07770 (AB3431_07770) - 1540505..1541083 (+) 579 WP_000846292.1 hypothetical protein -
  AB3431_RS07775 (AB3431_07775) - 1541101..1541319 (+) 219 WP_000448775.1 capsid morphogenesis B protein -
  AB3431_RS07780 (AB3431_07780) - 1541370..1541897 (+) 528 WP_000771356.1 spore coat protein -
  AB3431_RS07785 (AB3431_07785) - 1541900..1542241 (+) 342 WP_000358778.1 hypothetical protein -
  AB3431_RS07790 (AB3431_07790) - 1542238..1542807 (+) 570 WP_001293080.1 terminase small subunit -
  AB3431_RS07795 (AB3431_07795) - 1542854..1542937 (+) 84 Protein_1503 terminase small subunit -
  AB3431_RS07800 (AB3431_07800) - 1543084..1544052 (+) 969 WP_000801979.1 Abi family protein -
  AB3431_RS07805 (AB3431_07805) - 1544536..1544657 (+) 122 Protein_1505 hypothetical protein -
  AB3431_RS07810 (AB3431_07810) - 1544900..1545052 (+) 153 WP_001795626.1 hypothetical protein -
  AB3431_RS07815 (AB3431_07815) - 1545123..1545233 (+) 111 WP_000139423.1 hypothetical protein -
  AB3431_RS07820 (AB3431_07820) - 1545235..1545420 (+) 186 WP_001286805.1 hypothetical protein -
  AB3431_RS07825 (AB3431_07825) - 1546559..1547497 (-) 939 WP_001822249.1 Abi family protein -
  AB3431_RS07830 (AB3431_07830) - 1547536..1548243 (-) 708 Protein_1510 tyrosine-type recombinase/integrase -
  AB3431_RS07835 (AB3431_07835) selX 1548443..1549054 (+) 612 WP_000475326.1 staphylococcal enterotoxin-like toxin X -
  AB3431_RS07840 (AB3431_07840) - 1549423..1549791 (+) 369 WP_108932421.1 YxeA family protein -
  AB3431_RS07845 (AB3431_07845) - 1549972..1550544 (+) 573 WP_000769720.1 PepSY domain-containing protein -
  AB3431_RS07850 (AB3431_07850) - 1550682..1550945 (-) 264 WP_001055897.1 helix-turn-helix transcriptional regulator -
  AB3431_RS07855 (AB3431_07855) - 1551245..1551496 (+) 252 WP_000466748.1 GlsB/YeaQ/YmgE family stress response membrane protein -
  AB3431_RS07860 (AB3431_07860) - 1551535..1551744 (-) 210 WP_000211676.1 hypothetical protein -
  AB3431_RS07865 (AB3431_07865) - 1551922..1552503 (+) 582 WP_000158374.1 histidine phosphatase family protein -
  AB3431_RS07870 (AB3431_07870) - 1552569..1552952 (-) 384 WP_000868248.1 hypothetical protein -
  AB3431_RS07875 (AB3431_07875) - 1553207..1553833 (-) 627 WP_000746687.1 NDxxF motif lipoprotein -
  AB3431_RS07880 (AB3431_07880) - 1553906..1554148 (-) 243 Protein_1520 hypothetical protein -
  AB3431_RS07885 (AB3431_07885) ahpF 1554278..1555801 (-) 1524 WP_000930486.1 alkyl hydroperoxide reductase subunit F -
  AB3431_RS07890 (AB3431_07890) ahpC 1555817..1556386 (-) 570 WP_000052781.1 alkyl hydroperoxide reductase subunit C -
  AB3431_RS07895 (AB3431_07895) nfsA 1556878..1557633 (+) 756 WP_001289311.1 oxygen-insensitive NADPH nitroreductase -
  AB3431_RS07900 (AB3431_07900) - 1557714..1559102 (-) 1389 WP_000991007.1 L-cystine transporter -
  AB3431_RS07905 (AB3431_07905) - 1559187..1559288 (+) 102 WP_001789518.1 hypothetical protein -
  AB3431_RS07910 (AB3431_07910) - 1560079..1561035 (-) 957 WP_000956132.1 hypothetical protein -
  AB3431_RS07915 (AB3431_07915) - 1561153..1561815 (-) 663 WP_000394698.1 hypothetical protein -
  AB3431_RS07920 (AB3431_07920) - 1561958..1562365 (-) 408 WP_000763768.1 general stress protein -
  AB3431_RS07925 (AB3431_07925) xpt 1562878..1563456 (+) 579 WP_000421410.1 xanthine phosphoribosyltransferase -
  AB3431_RS07930 (AB3431_07930) pbuX 1563456..1564724 (+) 1269 WP_000793011.1 xanthine permease PbuX -
  AB3431_RS07935 (AB3431_07935) guaB 1564762..1566228 (+) 1467 WP_000264071.1 IMP dehydrogenase -
  AB3431_RS07940 (AB3431_07940) guaA 1566253..1567794 (+) 1542 WP_000424966.1 glutamine-hydrolyzing GMP synthase -
  AB3431_RS07945 (AB3431_07945) - 1567907..1568443 (-) 537 WP_000551776.1 hypothetical protein -
  AB3431_RS07950 (AB3431_07950) - 1568836..1569540 (-) 705 WP_000041883.1 type II toxin-antitoxin system PemK/MazF family toxin -
  AB3431_RS07955 (AB3431_07955) - 1569939..1570211 (-) 273 WP_000159787.1 transposase -
  AB3431_RS07960 (AB3431_07960) - 1570472..1570624 (-) 153 WP_000248839.1 hypothetical protein -
  AB3431_RS07965 (AB3431_07965) - 1571148..1571507 (-) 360 WP_001021618.1 DUF1304 domain-containing protein -

Sequence


Protein


Download         Length: 167 a.a.        Molecular weight: 18539.12 Da        Isoelectric Point: 4.7305

>NTDB_id=1026164 AB3431_RS07690 WP_000934799.1 1529845..1530348(+) (ssbA) [Staphylococcus aureus strain TUM20823]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=1026164 AB3431_RS07690 WP_000934799.1 1529845..1530348(+) (ssbA) [Staphylococcus aureus strain TUM20823]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7U7IE99

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.341

100

0.689

  ssb Latilactobacillus sakei subsp. sakei 23K

54.971

100

0.563

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

63.473

0.371

  ssb Glaesserella parasuis strain SC1401

34.463

100

0.365


Multiple sequence alignment