Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AB3447_RS04545 Genome accession   NZ_CP162456
Coordinates   899851..900321 (-) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain TUM20915     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 868122..911177 899851..900321 within 0


Gene organization within MGE regions


Location: 868122..911177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3447_RS04335 (AB3447_04335) - 868122..868679 (-) 558 WP_000528632.1 PBECR4 domain-containing protein -
  AB3447_RS04340 (AB3447_04340) - 869402..870847 (-) 1446 WP_001148136.1 SH3 domain-containing protein -
  AB3447_RS04345 (AB3447_04345) - 870828..871265 (-) 438 WP_031807125.1 phage holin -
  AB3447_RS04350 (AB3447_04350) - 871320..871715 (-) 396 WP_000387943.1 hypothetical protein -
  AB3447_RS04355 (AB3447_04355) - 871720..872958 (-) 1239 WP_368410596.1 BppU family phage baseplate upper protein -
  AB3447_RS04360 (AB3447_04360) - 872971..874869 (-) 1899 WP_000524006.1 N-acetylglucosaminidase -
  AB3447_RS04365 (AB3447_04365) - 875006..875305 (-) 300 WP_000466784.1 DUF2951 domain-containing protein -
  AB3447_RS04370 (AB3447_04370) - 875346..875519 (-) 174 WP_000782200.1 XkdX family protein -
  AB3447_RS04375 (AB3447_04375) - 875523..875900 (-) 378 WP_000705911.1 DUF2977 domain-containing protein -
  AB3447_RS04380 (AB3447_04380) - 875900..877723 (-) 1824 WP_368410597.1 phage baseplate upper protein -
  AB3447_RS04385 (AB3447_04385) - 877723..879633 (-) 1911 WP_000369012.1 hypothetical protein -
  AB3447_RS04390 (AB3447_04390) - 879648..881549 (-) 1902 WP_075111568.1 SGNH/GDSL hydrolase family protein -
  AB3447_RS04395 (AB3447_04395) - 881558..882505 (-) 948 WP_000350670.1 phage tail family protein -
  AB3447_RS04400 (AB3447_04400) - 882518..885850 (-) 3333 WP_368410598.1 hypothetical protein -
  AB3447_RS04405 (AB3447_04405) - 885867..886211 (-) 345 WP_000105584.1 hypothetical protein -
  AB3447_RS04410 (AB3447_04410) - 886241..886606 (-) 366 WP_001100161.1 tail assembly chaperone -
  AB3447_RS04415 (AB3447_04415) - 886668..887249 (-) 582 WP_000002577.1 phage major tail protein, TP901-1 family -
  AB3447_RS04420 (AB3447_04420) - 887268..887651 (-) 384 WP_000188649.1 hypothetical protein -
  AB3447_RS04425 (AB3447_04425) - 887663..888010 (-) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  AB3447_RS04430 (AB3447_04430) - 888010..888312 (-) 303 WP_001268313.1 hypothetical protein -
  AB3447_RS04435 (AB3447_04435) - 888309..888641 (-) 333 WP_000208960.1 phage head-tail connector protein -
  AB3447_RS04440 (AB3447_04440) - 888650..888937 (-) 288 WP_001114085.1 hypothetical protein -
  AB3447_RS04445 (AB3447_04445) - 888959..889933 (-) 975 WP_000438513.1 phage major capsid protein -
  AB3447_RS04450 (AB3447_04450) - 889947..890567 (-) 621 WP_368410599.1 DUF4355 domain-containing protein -
  AB3447_RS04455 (AB3447_04455) - 890555..890648 (-) 94 Protein_848 hypothetical protein -
  AB3447_RS04460 (AB3447_04460) - 890676..890846 (-) 171 WP_000072202.1 hypothetical protein -
  AB3447_RS04465 (AB3447_04465) - 890919..891914 (-) 996 WP_001668926.1 minor capsid protein -
  AB3447_RS04470 (AB3447_04470) - 891921..893459 (-) 1539 WP_000909971.1 phage portal protein -
  AB3447_RS04475 (AB3447_04475) - 893470..894747 (-) 1278 WP_000169946.1 PBSX family phage terminase large subunit -
  AB3447_RS04480 (AB3447_04480) - 894734..895174 (-) 441 WP_001003271.1 terminase small subunit -
  AB3447_RS04485 (AB3447_04485) - 895361..895783 (-) 423 WP_000162696.1 RinA family phage transcriptional activator -
  AB3447_RS04490 (AB3447_04490) - 895807..895953 (-) 147 WP_000989960.1 hypothetical protein -
  AB3447_RS04495 (AB3447_04495) - 895954..896319 (-) 366 WP_000989954.1 hypothetical protein -
  AB3447_RS04500 (AB3447_04500) - 896320..896616 (-) 297 WP_125571265.1 DUF1024 family protein -
  AB3447_RS04505 (AB3447_04505) - 896609..896917 (-) 309 WP_125571267.1 hypothetical protein -
  AB3447_RS04510 (AB3447_04510) - 896914..897261 (-) 348 WP_000979209.1 YopX family protein -
  AB3447_RS04515 (AB3447_04515) - 897258..897659 (-) 402 WP_000695762.1 hypothetical protein -
  AB3447_RS04520 (AB3447_04520) - 897672..897914 (-) 243 WP_063663525.1 SAV1978 family virulence-associated passenger protein -
  AB3447_RS04525 (AB3447_04525) - 897918..898286 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  AB3447_RS04530 (AB3447_04530) - 898299..898703 (-) 405 WP_368410600.1 RusA family crossover junction endodeoxyribonuclease -
  AB3447_RS04535 (AB3447_04535) - 898712..898930 (-) 219 WP_000338530.1 hypothetical protein -
  AB3447_RS04540 (AB3447_04540) - 898937..899821 (-) 885 WP_000148301.1 DnaD domain protein -
  AB3447_RS04545 (AB3447_04545) ssbA 899851..900321 (-) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  AB3447_RS04550 (AB3447_04550) - 900322..900939 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  AB3447_RS04555 (AB3447_04555) - 901020..901940 (-) 921 WP_000138472.1 recombinase RecT -
  AB3447_RS04560 (AB3447_04560) - 901942..903885 (-) 1944 WP_000700577.1 AAA family ATPase -
  AB3447_RS04565 (AB3447_04565) - 903894..904157 (-) 264 WP_001205732.1 hypothetical protein -
  AB3447_RS04570 (AB3447_04570) - 904166..904426 (-) 261 WP_000291503.1 DUF1108 family protein -
  AB3447_RS04575 (AB3447_04575) - 904407..904733 (-) 327 WP_000165362.1 DUF2482 family protein -
  AB3447_RS04580 (AB3447_04580) - 904828..904989 (-) 162 WP_000066025.1 DUF1270 domain-containing protein -
  AB3447_RS04585 (AB3447_04585) - 904982..905119 (-) 138 WP_000230552.1 hypothetical protein -
  AB3447_RS04590 (AB3447_04590) - 905169..905816 (+) 648 WP_086153461.1 hypothetical protein -
  AB3447_RS04595 (AB3447_04595) - 905838..905981 (-) 144 WP_000939498.1 hypothetical protein -
  AB3447_RS04600 (AB3447_04600) - 905997..906749 (-) 753 WP_001148595.1 phage antirepressor KilAC domain-containing protein -
  AB3447_RS04605 (AB3447_04605) - 906751..906936 (-) 186 WP_000933365.1 helix-turn-helix domain-containing protein -
  AB3447_RS04610 (AB3447_04610) - 907387..907623 (+) 237 WP_000856472.1 hypothetical protein -
  AB3447_RS04615 (AB3447_04615) - 907616..907777 (-) 162 WP_001153175.1 hypothetical protein -
  AB3447_RS04620 (AB3447_04620) - 907792..908046 (-) 255 WP_001106626.1 helix-turn-helix domain-containing protein -
  AB3447_RS04625 (AB3447_04625) - 908236..908874 (+) 639 WP_000874708.1 S24 family peptidase -
  AB3447_RS04630 (AB3447_04630) - 908906..909586 (+) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  AB3447_RS04635 (AB3447_04635) - 909792..911177 (+) 1386 WP_000861313.1 recombinase family protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=1025948 AB3447_RS04545 WP_000934770.1 899851..900321(-) (ssbA) [Staphylococcus aureus strain TUM20915]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=1025948 AB3447_RS04545 WP_000934770.1 899851..900321(-) (ssbA) [Staphylococcus aureus strain TUM20915]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404

  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365


Multiple sequence alignment