Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AB3430_RS10125 | Genome accession | NZ_CP162430 |
| Coordinates | 2017601..2018071 (+) | Length | 156 a.a. |
| NCBI ID | WP_125571269.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain TUM22702 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2006215..2049172 | 2017601..2018071 | within | 0 |
Gene organization within MGE regions
Location: 2006215..2049172
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB3430_RS10025 (AB3430_10025) | - | 2006215..2007600 (-) | 1386 | WP_196581100.1 | recombinase family protein | - |
| AB3430_RS10030 (AB3430_10030) | - | 2007807..2008487 (-) | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AB3430_RS10035 (AB3430_10035) | - | 2008519..2009244 (-) | 726 | WP_000661437.1 | PH domain-containing protein | - |
| AB3430_RS10040 (AB3430_10040) | - | 2009262..2009723 (-) | 462 | WP_000525009.1 | hypothetical protein | - |
| AB3430_RS10045 (AB3430_10045) | - | 2009736..2010059 (-) | 324 | WP_001260487.1 | helix-turn-helix domain-containing protein | - |
| AB3430_RS10050 (AB3430_10050) | - | 2010223..2010471 (+) | 249 | WP_341262164.1 | helix-turn-helix transcriptional regulator | - |
| AB3430_RS10055 (AB3430_10055) | - | 2010484..2010927 (+) | 444 | WP_023487065.1 | hypothetical protein | - |
| AB3430_RS10060 (AB3430_10060) | - | 2010942..2011085 (+) | 144 | WP_000939498.1 | hypothetical protein | - |
| AB3430_RS10065 (AB3430_10065) | - | 2011075..2011284 (-) | 210 | WP_000642492.1 | hypothetical protein | - |
| AB3430_RS10070 (AB3430_10070) | - | 2011724..2011909 (+) | 186 | WP_000933363.1 | helix-turn-helix domain-containing protein | - |
| AB3430_RS10075 (AB3430_10075) | - | 2011911..2012663 (+) | 753 | WP_023487064.1 | phage antirepressor KilAC domain-containing protein | - |
| AB3430_RS10080 (AB3430_10080) | - | 2012679..2012855 (+) | 177 | WP_001094935.1 | hypothetical protein | - |
| AB3430_RS10085 (AB3430_10085) | - | 2012830..2013060 (-) | 231 | WP_341262163.1 | hypothetical protein | - |
| AB3430_RS10090 (AB3430_10090) | - | 2013110..2013247 (+) | 138 | WP_000230552.1 | hypothetical protein | - |
| AB3430_RS10095 (AB3430_10095) | - | 2013240..2013401 (+) | 162 | WP_341262162.1 | DUF1270 family protein | - |
| AB3430_RS10100 (AB3430_10100) | - | 2013496..2013756 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| AB3430_RS10105 (AB3430_10105) | - | 2013765..2014028 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| AB3430_RS10110 (AB3430_10110) | - | 2014037..2015980 (+) | 1944 | WP_031788695.1 | AAA family ATPase | - |
| AB3430_RS10115 (AB3430_10115) | - | 2015982..2016902 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| AB3430_RS10120 (AB3430_10120) | - | 2016983..2017600 (+) | 618 | WP_072507301.1 | MBL fold metallo-hydrolase | - |
| AB3430_RS10125 (AB3430_10125) | ssbA | 2017601..2018071 (+) | 471 | WP_125571269.1 | single-stranded DNA-binding protein | Machinery gene |
| AB3430_RS10130 (AB3430_10130) | - | 2018101..2018985 (+) | 885 | WP_031873996.1 | DnaD domain protein | - |
| AB3430_RS10135 (AB3430_10135) | - | 2018992..2019210 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| AB3430_RS10140 (AB3430_10140) | - | 2019219..2019623 (+) | 405 | WP_000401972.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AB3430_RS10145 (AB3430_10145) | - | 2019636..2020004 (+) | 369 | WP_156979384.1 | SA1788 family PVL leukocidin-associated protein | - |
| AB3430_RS10150 (AB3430_10150) | - | 2020008..2020250 (+) | 243 | WP_000131379.1 | phi PVL orf 51-like protein | - |
| AB3430_RS10155 (AB3430_10155) | - | 2020259..2020630 (+) | 372 | WP_031859578.1 | hypothetical protein | - |
| AB3430_RS10160 (AB3430_10160) | - | 2020623..2020865 (+) | 243 | WP_031899413.1 | DUF1024 family protein | - |
| AB3430_RS10165 (AB3430_10165) | - | 2020865..2021071 (+) | 207 | WP_000097971.1 | Lar family restriction alleviation protein | - |
| AB3430_RS10170 (AB3430_10170) | - | 2021064..2021603 (+) | 540 | WP_341262161.1 | dUTP diphosphatase | - |
| AB3430_RS10175 (AB3430_10175) | - | 2021640..2021846 (+) | 207 | WP_000195785.1 | DUF1381 domain-containing protein | - |
| AB3430_RS10180 (AB3430_10180) | - | 2021843..2022037 (+) | 195 | WP_000132920.1 | hypothetical protein | - |
| AB3430_RS10185 (AB3430_10185) | - | 2022034..2022237 (+) | 204 | WP_001072797.1 | hypothetical protein | - |
| AB3430_RS10190 (AB3430_10190) | - | 2022230..2022403 (+) | 174 | WP_001657250.1 | transcriptional activator RinB | - |
| AB3430_RS10195 (AB3430_10195) | - | 2022404..2022550 (+) | 147 | WP_000990005.1 | hypothetical protein | - |
| AB3430_RS10200 (AB3430_10200) | - | 2022574..2022996 (+) | 423 | WP_000162701.1 | RinA family phage transcriptional activator | - |
| AB3430_RS10205 (AB3430_10205) | - | 2023184..2023678 (+) | 495 | WP_001038244.1 | terminase small subunit | - |
| AB3430_RS10210 (AB3430_10210) | - | 2023681..2024976 (+) | 1296 | WP_000273011.1 | PBSX family phage terminase large subunit | - |
| AB3430_RS10215 (AB3430_10215) | - | 2024987..2026522 (+) | 1536 | WP_031796092.1 | phage portal protein | - |
| AB3430_RS10220 (AB3430_10220) | - | 2026529..2027524 (+) | 996 | WP_001668926.1 | minor capsid protein | - |
| AB3430_RS10225 (AB3430_10225) | - | 2027597..2027767 (+) | 171 | WP_000072202.1 | hypothetical protein | - |
| AB3430_RS10230 (AB3430_10230) | - | 2027795..2027888 (+) | 94 | Protein_2003 | hypothetical protein | - |
| AB3430_RS10235 (AB3430_10235) | - | 2027876..2028496 (+) | 621 | WP_000392142.1 | DUF4355 domain-containing protein | - |
| AB3430_RS10240 (AB3430_10240) | - | 2028510..2029484 (+) | 975 | WP_033863203.1 | phage major capsid protein | - |
| AB3430_RS10245 (AB3430_10245) | - | 2029506..2029793 (+) | 288 | WP_001114085.1 | hypothetical protein | - |
| AB3430_RS10250 (AB3430_10250) | - | 2029802..2030134 (+) | 333 | WP_000208959.1 | phage head-tail connector protein | - |
| AB3430_RS10255 (AB3430_10255) | - | 2030131..2030433 (+) | 303 | WP_001268304.1 | hypothetical protein | - |
| AB3430_RS10260 (AB3430_10260) | - | 2030433..2030780 (+) | 348 | WP_001017811.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| AB3430_RS10265 (AB3430_10265) | - | 2030792..2031175 (+) | 384 | WP_000188653.1 | hypothetical protein | - |
| AB3430_RS10270 (AB3430_10270) | - | 2031194..2031775 (+) | 582 | WP_000002583.1 | phage major tail protein, TP901-1 family | - |
| AB3430_RS10275 (AB3430_10275) | - | 2031837..2032202 (+) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| AB3430_RS10280 (AB3430_10280) | - | 2032232..2032576 (+) | 345 | WP_000105584.1 | hypothetical protein | - |
| AB3430_RS10285 (AB3430_10285) | - | 2032593..2036057 (+) | 3465 | WP_031784306.1 | membrane protein | - |
| AB3430_RS10290 (AB3430_10290) | - | 2036070..2037017 (+) | 948 | WP_000350670.1 | phage tail family protein | - |
| AB3430_RS10295 (AB3430_10295) | - | 2037026..2038927 (+) | 1902 | WP_075111568.1 | SGNH/GDSL hydrolase family protein | - |
| AB3430_RS10300 (AB3430_10300) | - | 2038942..2040852 (+) | 1911 | WP_000369012.1 | hypothetical protein | - |
| AB3430_RS10305 (AB3430_10305) | - | 2040852..2042675 (+) | 1824 | WP_000259632.1 | phage baseplate upper protein | - |
| AB3430_RS10310 (AB3430_10310) | - | 2042675..2043052 (+) | 378 | WP_000705896.1 | DUF2977 domain-containing protein | - |
| AB3430_RS10315 (AB3430_10315) | - | 2043056..2043229 (+) | 174 | WP_000782200.1 | XkdX family protein | - |
| AB3430_RS10320 (AB3430_10320) | - | 2043269..2043568 (+) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| AB3430_RS10325 (AB3430_10325) | - | 2043705..2045603 (+) | 1899 | WP_000524023.1 | glucosaminidase domain-containing protein | - |
| AB3430_RS10330 (AB3430_10330) | - | 2045616..2046854 (+) | 1239 | WP_000276637.1 | BppU family phage baseplate upper protein | - |
| AB3430_RS10335 (AB3430_10335) | - | 2046859..2047254 (+) | 396 | WP_000387943.1 | hypothetical protein | - |
| AB3430_RS10340 (AB3430_10340) | - | 2047309..2047746 (+) | 438 | WP_000354128.1 | phage holin | - |
| AB3430_RS10345 (AB3430_10345) | - | 2047727..2049172 (+) | 1446 | WP_001148135.1 | SH3 domain-containing protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17595.36 Da Isoelectric Point: 4.9327
>NTDB_id=1025379 AB3430_RS10125 WP_125571269.1 2017601..2018071(+) (ssbA) [Staphylococcus aureus strain TUM22702]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFVNCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=1025379 AB3430_RS10125 WP_125571269.1 2017601..2018071(+) (ssbA) [Staphylococcus aureus strain TUM22702]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTGTTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
60.452 |
100 |
0.686 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.564 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |