Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   AB3L01_RS02720 Genome accession   NZ_CP162145
Coordinates   555008..555361 (-) Length   117 a.a.
NCBI ID   WP_002014678.1    Uniprot ID   A0A0D5YEH0
Organism   Acinetobacter baumannii strain SIMBA089     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 552642..583978 555008..555361 within 0


Gene organization within MGE regions


Location: 552642..583978
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB3L01_RS02700 (AB3L01_02700) - 552642..553709 (+) 1068 WP_000107854.1 site-specific integrase -
  AB3L01_RS02705 (AB3L01_02705) - 553737..554033 (-) 297 WP_000218943.1 hypothetical protein -
  AB3L01_RS02710 (AB3L01_02710) - 554030..554251 (-) 222 WP_000424605.1 hypothetical protein -
  AB3L01_RS02715 (AB3L01_02715) - 554261..554998 (-) 738 WP_000125747.1 3'-5' exonuclease -
  AB3L01_RS02720 (AB3L01_02720) ssb 555008..555361 (-) 354 WP_002014678.1 single-stranded DNA-binding protein Machinery gene
  AB3L01_RS02725 (AB3L01_02725) - 555349..555666 (-) 318 WP_000049658.1 hypothetical protein -
  AB3L01_RS02730 (AB3L01_02730) - 555659..555829 (-) 171 WP_106908016.1 hypothetical protein -
  AB3L01_RS02735 (AB3L01_02735) - 555819..556370 (-) 552 WP_001178668.1 hypothetical protein -
  AB3L01_RS02740 (AB3L01_02740) - 556436..556768 (-) 333 WP_000632296.1 hypothetical protein -
  AB3L01_RS02745 (AB3L01_02745) - 556765..559503 (-) 2739 WP_002014340.1 toprim domain-containing protein -
  AB3L01_RS02750 (AB3L01_02750) - 559597..559788 (-) 192 WP_001043481.1 hypothetical protein -
  AB3L01_RS02755 (AB3L01_02755) - 559881..560222 (+) 342 WP_000786719.1 helix-turn-helix transcriptional regulator -
  AB3L01_RS02760 (AB3L01_02760) - 560267..560482 (-) 216 WP_000556351.1 hypothetical protein -
  AB3L01_RS02765 (AB3L01_02765) - 560607..561422 (-) 816 WP_001094886.1 Rha family transcriptional regulator -
  AB3L01_RS02770 (AB3L01_02770) - 561530..561724 (-) 195 WP_000696053.1 hypothetical protein -
  AB3L01_RS02775 (AB3L01_02775) - 562034..562912 (+) 879 WP_000417952.1 BRCT domain-containing protein -
  AB3L01_RS02780 (AB3L01_02780) - 562912..563193 (+) 282 WP_000713873.1 hypothetical protein -
  AB3L01_RS02785 (AB3L01_02785) - 563509..563709 (-) 201 WP_000130085.1 TraR/DksA C4-type zinc finger protein -
  AB3L01_RS02790 (AB3L01_02790) - 563706..563945 (-) 240 WP_000113725.1 ogr/Delta-like zinc finger family protein -
  AB3L01_RS02795 (AB3L01_02795) - 564075..565388 (-) 1314 WP_000483061.1 contractile injection system protein, VgrG/Pvc8 family -
  AB3L01_RS02800 (AB3L01_02800) - 565389..565829 (-) 441 WP_000979757.1 phage tail protein -
  AB3L01_RS02805 (AB3L01_02805) - 565835..568285 (-) 2451 WP_000774268.1 phage tail tape measure protein -
  AB3L01_RS02810 (AB3L01_02810) - 568299..568436 (-) 138 WP_096903806.1 GpE family phage tail protein -
  AB3L01_RS02815 (AB3L01_02815) - 568439..568780 (-) 342 WP_001071615.1 phage tail assembly protein -
  AB3L01_RS02820 (AB3L01_02820) - 568847..569365 (-) 519 WP_001207612.1 phage major tail tube protein -
  AB3L01_RS02825 (AB3L01_02825) - 569378..570553 (-) 1176 WP_000963361.1 phage tail sheath protein -
  AB3L01_RS02830 (AB3L01_02830) - 570703..572655 (-) 1953 WP_000729646.1 phage tail protein -
  AB3L01_RS02835 (AB3L01_02835) - 572667..573272 (-) 606 WP_001050805.1 phage tail protein I -
  AB3L01_RS02840 (AB3L01_02840) - 573272..574174 (-) 903 WP_000109738.1 baseplate J/gp47 family protein -
  AB3L01_RS02845 (AB3L01_02845) - 574171..574518 (-) 348 WP_000987745.1 GPW/gp25 family protein -
  AB3L01_RS02850 (AB3L01_02850) - 574515..575147 (-) 633 WP_000990625.1 phage baseplate assembly protein V -
  AB3L01_RS02855 (AB3L01_02855) - 575220..575669 (-) 450 WP_001059843.1 phage virion morphogenesis protein -
  AB3L01_RS02860 (AB3L01_02860) - 575666..576193 (-) 528 WP_000742888.1 phage tail protein -
  AB3L01_RS02865 (AB3L01_02865) - 576190..577020 (-) 831 WP_000600982.1 N-acetylmuramidase family protein -
  AB3L01_RS02870 (AB3L01_02870) - 577017..577286 (-) 270 WP_000571491.1 phage holin family protein -
  AB3L01_RS02875 (AB3L01_02875) - 577283..577633 (-) 351 WP_001114936.1 putative holin -
  AB3L01_RS02880 (AB3L01_02880) - 577642..577851 (-) 210 WP_000659474.1 tail protein X -
  AB3L01_RS02885 (AB3L01_02885) - 577852..578304 (-) 453 WP_000015691.1 head completion/stabilization protein -
  AB3L01_RS02890 (AB3L01_02890) gpM 578408..579154 (-) 747 WP_000950641.1 phage terminase small subunit -
  AB3L01_RS02895 (AB3L01_02895) - 579165..580154 (-) 990 WP_001243259.1 phage major capsid protein, P2 family -
  AB3L01_RS02900 (AB3L01_02900) - 580207..581034 (-) 828 WP_000748563.1 GPO family capsid scaffolding protein -
  AB3L01_RS02905 (AB3L01_02905) - 581172..582980 (+) 1809 WP_000289874.1 terminase family protein -
  AB3L01_RS02910 (AB3L01_02910) - 582980..583978 (+) 999 WP_001284079.1 phage portal protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13365.13 Da        Isoelectric Point: 9.7939

>NTDB_id=1024235 AB3L01_RS02720 WP_002014678.1 555008..555361(-) (ssb) [Acinetobacter baumannii strain SIMBA089]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=1024235 AB3L01_RS02720 WP_002014678.1 555008..555361(-) (ssb) [Acinetobacter baumannii strain SIMBA089]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0D5YEH0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

55.455

94.017

0.521
  ssb Vibrio cholerae strain A1552

54.545

84.615

0.462
  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385
  ssb Neisseria meningitidis MC58

42.857

89.744

0.385

Multiple sequence alignment