Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   AB0R90_RS12840 Genome accession   NZ_CP160217
Coordinates   2609740..2610177 (-) Length   145 a.a.
NCBI ID   WP_012117983.1    Uniprot ID   -
Organism   Bacillus velezensis strain AP52     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2604740..2615177
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R90_RS12790 (AB0R90_12790) sinI 2605124..2605297 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R90_RS12795 (AB0R90_12795) sinR 2605331..2605666 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R90_RS12800 (AB0R90_12800) tasA 2605714..2606499 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R90_RS12805 (AB0R90_12805) sipW 2606564..2607148 (-) 585 WP_012117977.1 signal peptidase I SipW -
  AB0R90_RS12810 (AB0R90_12810) tapA 2607120..2607791 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R90_RS12815 (AB0R90_12815) - 2608050..2608379 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  AB0R90_RS12820 (AB0R90_12820) - 2608419..2608598 (-) 180 WP_059368116.1 YqzE family protein -
  AB0R90_RS12825 (AB0R90_12825) comGG 2608655..2609032 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R90_RS12830 (AB0R90_12830) comGF 2609033..2609533 (-) 501 WP_257474763.1 competence type IV pilus minor pilin ComGF -
  AB0R90_RS12835 (AB0R90_12835) comGE 2609442..2609756 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  AB0R90_RS12840 (AB0R90_12840) comGD 2609740..2610177 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  AB0R90_RS12845 (AB0R90_12845) comGC 2610167..2610475 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  AB0R90_RS12850 (AB0R90_12850) comGB 2610480..2611517 (-) 1038 WP_099566903.1 competence type IV pilus assembly protein ComGB Machinery gene
  AB0R90_RS12855 (AB0R90_12855) comGA 2611504..2612574 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  AB0R90_RS12860 (AB0R90_12860) - 2612771..2613721 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  AB0R90_RS12865 (AB0R90_12865) - 2613867..2615168 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16286.74 Da        Isoelectric Point: 10.2475

>NTDB_id=1019470 AB0R90_RS12840 WP_012117983.1 2609740..2610177(-) (comGD) [Bacillus velezensis strain AP52]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=1019470 AB0R90_RS12840 WP_012117983.1 2609740..2610177(-) (comGD) [Bacillus velezensis strain AP52]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572


Multiple sequence alignment