Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R90_RS12790 | Genome accession | NZ_CP160217 |
| Coordinates | 2605124..2605297 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain AP52 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2600124..2610297
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R90_RS12775 (AB0R90_12775) | gcvT | 2600937..2602037 (-) | 1101 | WP_099566902.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R90_RS12780 (AB0R90_12780) | - | 2602461..2604131 (+) | 1671 | WP_025284995.1 | SNF2-related protein | - |
| AB0R90_RS12785 (AB0R90_12785) | - | 2604153..2604947 (+) | 795 | WP_015240204.1 | YqhG family protein | - |
| AB0R90_RS12790 (AB0R90_12790) | sinI | 2605124..2605297 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R90_RS12795 (AB0R90_12795) | sinR | 2605331..2605666 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R90_RS12800 (AB0R90_12800) | tasA | 2605714..2606499 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R90_RS12805 (AB0R90_12805) | sipW | 2606564..2607148 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| AB0R90_RS12810 (AB0R90_12810) | tapA | 2607120..2607791 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R90_RS12815 (AB0R90_12815) | - | 2608050..2608379 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| AB0R90_RS12820 (AB0R90_12820) | - | 2608419..2608598 (-) | 180 | WP_059368116.1 | YqzE family protein | - |
| AB0R90_RS12825 (AB0R90_12825) | comGG | 2608655..2609032 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R90_RS12830 (AB0R90_12830) | comGF | 2609033..2609533 (-) | 501 | WP_257474763.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R90_RS12835 (AB0R90_12835) | comGE | 2609442..2609756 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R90_RS12840 (AB0R90_12840) | comGD | 2609740..2610177 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019467 AB0R90_RS12790 WP_003153105.1 2605124..2605297(+) (sinI) [Bacillus velezensis strain AP52]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019467 AB0R90_RS12790 WP_003153105.1 2605124..2605297(+) (sinI) [Bacillus velezensis strain AP52]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |