Detailed information NTG1019319

Bioinformatically predicted

Overview

• Name: comGD
• Type: Machinery gene
• Locus tag: AB0R81_RS12030
• Genome accession: NZ_CP160215
• Coordinates: 2491045..2491482 (-)
• Length: 145 a.a.
• NCBI ID: WP_012117983.1
• Uniprot ID: -
• Organism: Bacillus velezensis strain JJ213
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2486045..2496482

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AB0R81_RS11980 (AB0R81_11980)	sinI	2486429..2486602 (+)	174	WP_003153105.1	anti-repressor SinI	Regulator
AB0R81_RS11985 (AB0R81_11985)	sinR	2486636..2486971 (+)	336	WP_003153104.1	transcriptional regulator SinR	Regulator
AB0R81_RS11990 (AB0R81_11990)	tasA	2487019..2487804 (-)	786	WP_007408329.1	biofilm matrix protein TasA	-
AB0R81_RS11995 (AB0R81_11995)	sipW	2487869..2488453 (-)	585	WP_007408328.1	signal peptidase I SipW	-
AB0R81_RS12000 (AB0R81_12000)	tapA	2488425..2489096 (-)	672	WP_042635356.1	amyloid fiber anchoring/assembly protein TapA	-
AB0R81_RS12005 (AB0R81_12005)	-	2489355..2489684 (+)	330	WP_020954231.1	DUF3889 domain-containing protein	-
AB0R81_RS12010 (AB0R81_12010)	-	2489724..2489903 (-)	180	WP_003153093.1	YqzE family protein	-
AB0R81_RS12015 (AB0R81_12015)	comGG	2489960..2490337 (-)	378	WP_032866434.1	competence type IV pilus minor pilin ComGG	Machinery gene
AB0R81_RS12020 (AB0R81_12020)	comGF	2490338..2490838 (-)	501	WP_262982688.1	competence type IV pilus minor pilin ComGF	-
AB0R81_RS12025 (AB0R81_12025)	comGE	2490747..2491061 (-)	315	WP_007408323.1	competence type IV pilus minor pilin ComGE	-
AB0R81_RS12030 (AB0R81_12030)	comGD	2491045..2491482 (-)	438	WP_012117983.1	competence type IV pilus minor pilin ComGD	Machinery gene
AB0R81_RS12035 (AB0R81_12035)	comGC	2491472..2491780 (-)	309	WP_003153087.1	competence type IV pilus major pilin ComGC	Machinery gene
AB0R81_RS12040 (AB0R81_12040)	comGB	2491785..2492822 (-)	1038	WP_032866436.1	competence type IV pilus assembly protein ComGB	Machinery gene
AB0R81_RS12045 (AB0R81_12045)	comGA	2492809..2493879 (-)	1071	WP_012117985.1	competence type IV pilus ATPase ComGA	Machinery gene
AB0R81_RS12050 (AB0R81_12050)	-	2494071..2495021 (-)	951	WP_032870601.1	magnesium transporter CorA family protein	-
AB0R81_RS12055 (AB0R81_12055)	-	2495167..2496468 (+)	1302	WP_012117986.1	hemolysin family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16286.74 Da
• Isoelectric Point: 10.2475

>NTDB_id=1019319 AB0R81_RS12030 WP_012117983.1 2491045..2491482(-) (comGD) [Bacillus velezensis strain JJ213]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide

• Length: 438 bp

>NTDB_id=1019319 AB0R81_RS12030 WP_012117983.1 2491045..2491482(-) (comGD) [Bacillus velezensis strain JJ213]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-31)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGD	Bacillus subtilis subsp. subtilis str. 168	56.849	100	0.572