Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | AB0R81_RS11980 | Genome accession | NZ_CP160215 |
| Coordinates | 2486429..2486602 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain JJ213 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2481429..2491602
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB0R81_RS11965 (AB0R81_11965) | gcvT | 2482242..2483342 (-) | 1101 | WP_042635355.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| AB0R81_RS11970 (AB0R81_11970) | - | 2483766..2485436 (+) | 1671 | WP_031378948.1 | SNF2-related protein | - |
| AB0R81_RS11975 (AB0R81_11975) | - | 2485458..2486252 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| AB0R81_RS11980 (AB0R81_11980) | sinI | 2486429..2486602 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| AB0R81_RS11985 (AB0R81_11985) | sinR | 2486636..2486971 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| AB0R81_RS11990 (AB0R81_11990) | tasA | 2487019..2487804 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| AB0R81_RS11995 (AB0R81_11995) | sipW | 2487869..2488453 (-) | 585 | WP_007408328.1 | signal peptidase I SipW | - |
| AB0R81_RS12000 (AB0R81_12000) | tapA | 2488425..2489096 (-) | 672 | WP_042635356.1 | amyloid fiber anchoring/assembly protein TapA | - |
| AB0R81_RS12005 (AB0R81_12005) | - | 2489355..2489684 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| AB0R81_RS12010 (AB0R81_12010) | - | 2489724..2489903 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| AB0R81_RS12015 (AB0R81_12015) | comGG | 2489960..2490337 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| AB0R81_RS12020 (AB0R81_12020) | comGF | 2490338..2490838 (-) | 501 | WP_262982688.1 | competence type IV pilus minor pilin ComGF | - |
| AB0R81_RS12025 (AB0R81_12025) | comGE | 2490747..2491061 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| AB0R81_RS12030 (AB0R81_12030) | comGD | 2491045..2491482 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=1019316 AB0R81_RS11980 WP_003153105.1 2486429..2486602(+) (sinI) [Bacillus velezensis strain JJ213]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=1019316 AB0R81_RS11980 WP_003153105.1 2486429..2486602(+) (sinI) [Bacillus velezensis strain JJ213]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |