Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   AB0R81_RS11980 Genome accession   NZ_CP160215
Coordinates   2486429..2486602 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain JJ213     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2481429..2491602
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AB0R81_RS11965 (AB0R81_11965) gcvT 2482242..2483342 (-) 1101 WP_042635355.1 glycine cleavage system aminomethyltransferase GcvT -
  AB0R81_RS11970 (AB0R81_11970) - 2483766..2485436 (+) 1671 WP_031378948.1 SNF2-related protein -
  AB0R81_RS11975 (AB0R81_11975) - 2485458..2486252 (+) 795 WP_007408330.1 YqhG family protein -
  AB0R81_RS11980 (AB0R81_11980) sinI 2486429..2486602 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  AB0R81_RS11985 (AB0R81_11985) sinR 2486636..2486971 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  AB0R81_RS11990 (AB0R81_11990) tasA 2487019..2487804 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  AB0R81_RS11995 (AB0R81_11995) sipW 2487869..2488453 (-) 585 WP_007408328.1 signal peptidase I SipW -
  AB0R81_RS12000 (AB0R81_12000) tapA 2488425..2489096 (-) 672 WP_042635356.1 amyloid fiber anchoring/assembly protein TapA -
  AB0R81_RS12005 (AB0R81_12005) - 2489355..2489684 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  AB0R81_RS12010 (AB0R81_12010) - 2489724..2489903 (-) 180 WP_003153093.1 YqzE family protein -
  AB0R81_RS12015 (AB0R81_12015) comGG 2489960..2490337 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  AB0R81_RS12020 (AB0R81_12020) comGF 2490338..2490838 (-) 501 WP_262982688.1 competence type IV pilus minor pilin ComGF -
  AB0R81_RS12025 (AB0R81_12025) comGE 2490747..2491061 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  AB0R81_RS12030 (AB0R81_12030) comGD 2491045..2491482 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=1019316 AB0R81_RS11980 WP_003153105.1 2486429..2486602(+) (sinI) [Bacillus velezensis strain JJ213]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=1019316 AB0R81_RS11980 WP_003153105.1 2486429..2486602(+) (sinI) [Bacillus velezensis strain JJ213]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702


Multiple sequence alignment